KEGG   Geobacillus sp. WCH70: GWCH70_2183Help
Entry
GWCH70_2183       CDS       T00915                                 

Definition
Glu/Leu/Phe/Val dehydrogenase
Orthology
K00260  
glutamate dehydrogenase [EC:1.4.1.2]
Organism
gwc  Geobacillus sp. WCH70
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
Taurine and hypotaurine metabolism
Nitrogen metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gwc00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    GWCH70_2183
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    GWCH70_2183
   00330 Arginine and proline metabolism
    GWCH70_2183
  Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    GWCH70_2183
Enzymes [BR:gwc01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.2  glutamate dehydrogenase
     GWCH70_2183
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2245383..2246669)
Genome map
AA seq 428 aa AA seqDB search
MVADKHTNEENLEEKAEKYDVLTATQTVIHRALEKLGYPEEVYELLKEPIRMLTVRIPVR
MDDGTVKIFTGYRAQHNDAVGPTKGGVRFHPNVTEREVKALSIWMSLKCGIVDLPYGGGK
GGIVCDPRTMSFRELERLSRGYVRAISQIVGPTKDIPAPDVFTNSQIMAWMMDEYSRIDE
FNSPGFITGKPLVLGGSHGRETATAKGVTICIREAAKKRGIDLKGARVVVQGFGNAGSYL
AKFMYDAGAKVIGISDVYGALYDPNGLDIDYLLERRDSFGTVTKLFKNTITNKELLELDC
DILVPAAIENQITKENAPNIKASIVVEAANGPTTLEATEILTERGILLVPDVLASAGGVT
VSYFEWVQNNQGYYWTEEEVQERLEKVMVKAFNNVYEMAQTRRVDMRLAAYMVGVRKMAE
ACRFRGWV
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atggtagccgacaagcataccaacgaagaaaatctggaagaaaaagcggaaaaatatgat
gtattaacagcaacacaaactgttatacatagagcattggaaaaattagggtatccagaa
gaagtatatgagttgctcaaagagccgattcgcatgctgacagtgagaattcctgtgcgc
atggatgacggtactgtaaaaatttttaccggctaccgtgcccagcataatgatgccgtt
ggtccaactaaggggggcgttcgtttccatccaaacgtaacagagcgtgaagtgaaagcg
ctgtctatttggatgagcctaaaatgtggcattgtcgatttgccgtatggcggtggaaaa
ggcggaattgtatgtgatccgcgtacgatgtcattccgtgaattagaacgattaagccgt
ggttatgttcgcgcgattagccaaatcgttggtccgacaaaagacattcctgcaccagat
gtctttacgaactcgcaaattatggcatggatgatggacgaatatagccgcatcgacgaa
tttaactctcctggatttattacaggaaaacctttagtgctaggcgggtcgcacgggcgc
gaaaccgcgacggcaaaaggggttacgatttgtattcgcgaagcggcgaaaaaacgcggt
atcgacttgaaaggagcacgcgtggtcgttcaaggttttggaaacgcgggaagctattta
gcaaaatttatgtatgatgccggtgcgaaagtcattggcatttccgacgtatatggagct
ctttacgatccgaacggtttagatatcgattatttgcttgagcgccgcgacagctttggt
acggtaacgaaattgtttaaaaatacaattacgaacaaagaattgttagagcttgattgc
gatattttagttccagccgcaattgaaaatcaaattacgaaagaaaatgcgccaaatatt
aaagcaagcattgtcgtggaggcggcaaacggtccaacgacgctagaggcgacggaaatt
ttaacggaacgcggcattttgcttgttccagacgtattagctagtgccggcggtgtaacg
gtatcctattttgaatgggtgcaaaataaccaaggatattattggacagaagaagaagtc
caagaacgattagaaaaagtgatggtaaaagcgtttaacaacgtatatgaaatggcgcaa
acccgccgcgtagatatgcgattggctgcttatatggtcggcgttcgaaaaatggcggaa
gcgtgccgtttccgcggatgggtataa

DBGET integrated database retrieval system