KEGG   Geobacillus sp. WCH70: GWCH70_2378Help
Entry
GWCH70_2378       CDS       T00915                                 

Definition
ROK family glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
gwc  Geobacillus sp. WCH70
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:gwc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    GWCH70_2378
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GWCH70_2378
   00052 Galactose metabolism
    GWCH70_2378
   00500 Starch and sucrose metabolism
    GWCH70_2378
   00520 Amino sugar and nucleotide sugar metabolism
    GWCH70_2378
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    GWCH70_2378
   00524 Butirosin and neomycin biosynthesis
    GWCH70_2378
Enzymes [BR:gwc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     GWCH70_2378
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2418946..2419902)
Genome map
AA seq 318 aa AA seqDB search
MTEKWLVGVDLGGTTTKMAFVTTDGDIVHKWEIDTDISNKGENIVKHISQSLEETLHHLG
ESKDRLLAIGIGAPGPVHMETGMLYEAVNLGWKNYPLKDRLERETSLPVAVDNDANIAAL
GEMWKGAGSGARDLICVTLGTGVGGGVIANGQIVHGVNGAGGEIGHMTMLPKGGAPCNCG
KTGCLETIASATGIVRIAKEKLSHWDKPTLLRDETVTAKAVFDAARANDELALEVVDEVM
FYLGLALANAANVSNPEKIVIGGGVSKAGNILVERVSTYFRRFAFPRVAEGATIVLATLG
NDAGVIGGAWLAKMSLSV
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgacggaaaaatggcttgttggagtggatttaggcggaacgacgactaaaatggcgttt
gtgacaacagatggtgatatcgtacataaatgggagatcgataccgatatttcgaacaaa
ggggaaaacattgtaaagcatatatcacaatcgctagaggagacgttacatcaccttgga
gaaagcaaagatcggcttttagccattgggatcggcgcgccgggaccggtgcatatggaa
acagggatgctttatgaagcggtgaatttagggtggaaaaattacccattaaaagatcgg
cttgagcgagaaacatcccttcctgtagcggtggacaatgatgcgaatattgccgccctc
ggggaaatgtggaaaggagctggaagtggcgcgcgcgaccttatttgcgtcacacttggt
accggtgtcggaggtggggttattgccaatggtcaaattgtgcacggcgtaaacggtgcc
ggtggagaaatcggccacatgacaatgcttccaaaaggcggtgcgccgtgtaattgcggt
aaaaccggctgtttggaaacgattgcttctgctacgggaattgtaagaatcgcaaaagaa
aaattatcacattgggataaaccgactttgcttcgcgatgaaaccgtaactgccaaagcg
gtatttgacgcggcgagagcgaatgacgaactagcgctcgaggttgtggatgaagtgatg
ttttacctcggactggcattggcgaatgcagcgaatgtgtcaaatccggaaaaaatcgtt
attggcggcggtgtgtcaaaagcaggtaatatattagtagaacgtgtcagtacttatttc
cgtcgttttgcgtttccgcgtgtcgcggagggagccacgattgtattggcgacgcttggc
aatgatgcgggagtaattggcggtgcatggttggcaaaaatgtcactgtctgtttga

DBGET integrated database retrieval system