KEGG   Geobacillus sp. WCH70: GWCH70_2627Help
Entry
GWCH70_2627       CDS       T00915                                 

Definition
(GenBank) Enoyl-CoA hydratase/isomerase
  KO
K13767  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
gwc  Geobacillus sp. WCH70
Pathway
gwc00071  Fatty acid degradation
gwc00362  Benzoate degradation
gwc01100  Metabolic pathways
gwc01120  Microbial metabolism in diverse environments
gwc01212  Fatty acid metabolism
Module
gwc_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:gwc00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    GWCH70_2627
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    GWCH70_2627
Enzymes [BR:gwc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     GWCH70_2627
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2 DUF2309
Motif
Other DBs
NCBI-ProteinID: ACS25321
JGI: GWCH70_2627
UniProt: C5D5Q3
Position
complement(2661686..2662459)
Genome map
AA seq 257 aa AA seqDB search
MEFFRIHKEEFVADVTFSRPPANALSSAVLKELSALLDELEADDNVRVVLLHGEGRFFSA
GADIKEFTSIASSDEATALSQNGQQVLERIERFPKPVIAAIHGAALGGGLELAMSCHIRI
VSENAKLGLPELQLGIIPGFAGTQRLPRYVGFGKAAEMMLTSEPITGAEAVQWGLANKAV
PEEQLLEEAKKLAKKIAQKGPISVRATLQLLNSFKEKPFQEAMREEAELFGSMFTTEDAK
EGVQAFIEKRPPIFHGK
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atggaattttttcgtatccataaagaagagtttgtcgcggacgtaacgttttctcgtccg
ccggcaaacgctctttcatccgctgtgttgaaagagctttcagccttgctcgatgagctg
gaggcggatgataacgtccgtgttgtgcttcttcacggcgaaggaagatttttctccgca
ggagcggatattaaagagtttacttctatagcgtccagcgatgaagcgacagcgctgtcg
caaaatggacagcaagtgttggaacgaatcgagcgctttccaaagccagtgattgcggcc
atccatggcgcagcgctaggcggtggactggagctggcgatgagctgccatatccgcatt
gtttccgaaaacgccaaactcggcctgccagagctgcagcttggcatcatacctggcttt
gccggcacgcagcggcttcctcgctacgtcggcttcggcaaagcggctgagatgatgttg
acgagcgagccgattaccggagcagaagcggtgcagtggggattagcaaacaaagcggtg
ccagaagaacaattgctcgaggaagcaaaaaaactggcgaaaaaaatcgcgcaaaaaggc
ccgatttcggttcgcgctacattgcagcttttaaattcttttaaagaaaaaccattccaa
gaagcaatgcgtgaggaagcggagctgtttggaagcatgttcacaacagaagacgcgaaa
gaaggagtgcaagcgttcattgaaaagcgtccgccgatctttcatggtaaataa

DBGET integrated database retrieval system