KEGG   Geobacillus sp. WCH70: GWCH70_2627Help
Entry
GWCH70_2627       CDS       T00915                                 

Definition
enoyl-CoA hydratase
Orthology
K13767  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
gwc  Geobacillus sp. WCH70
Pathway
Fatty acid degradation
Metabolic pathways
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:gwc00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    GWCH70_2627
  Lipid metabolism
   00071 Fatty acid degradation
    GWCH70_2627
Enzymes [BR:gwc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     GWCH70_2627
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2661686..2662459)
Genome map
AA seq 257 aa AA seqDB search
MEFFRIHKEEFVADVTFSRPPANALSSAVLKELSALLDELEADDNVRVVLLHGEGRFFSA
GADIKEFTSIASSDEATALSQNGQQVLERIERFPKPVIAAIHGAALGGGLELAMSCHIRI
VSENAKLGLPELQLGIIPGFAGTQRLPRYVGFGKAAEMMLTSEPITGAEAVQWGLANKAV
PEEQLLEEAKKLAKKIAQKGPISVRATLQLLNSFKEKPFQEAMREEAELFGSMFTTEDAK
EGVQAFIEKRPPIFHGK
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atggaattttttcgtatccataaagaagagtttgtcgcggacgtaacgttttctcgtccg
ccggcaaacgctctttcatccgctgtgttgaaagagctttcagccttgctcgatgagctg
gaggcggatgataacgtccgtgttgtgcttcttcacggcgaaggaagatttttctccgca
ggagcggatattaaagagtttacttctatagcgtccagcgatgaagcgacagcgctgtcg
caaaatggacagcaagtgttggaacgaatcgagcgctttccaaagccagtgattgcggcc
atccatggcgcagcgctaggcggtggactggagctggcgatgagctgccatatccgcatt
gtttccgaaaacgccaaactcggcctgccagagctgcagcttggcatcatacctggcttt
gccggcacgcagcggcttcctcgctacgtcggcttcggcaaagcggctgagatgatgttg
acgagcgagccgattaccggagcagaagcggtgcagtggggattagcaaacaaagcggtg
ccagaagaacaattgctcgaggaagcaaaaaaactggcgaaaaaaatcgcgcaaaaaggc
ccgatttcggttcgcgctacattgcagcttttaaattcttttaaagaaaaaccattccaa
gaagcaatgcgtgaggaagcggagctgtttggaagcatgttcacaacagaagacgcgaaa
gaaggagtgcaagcgttcattgaaaagcgtccgccgatctttcatggtaaataa

DBGET integrated database retrieval system