KEGG   Geobacillus sp. WCH70: GWCH70_2655Help
Entry
GWCH70_2655       CDS       T00915                                 

Definition
cellulase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
gwc  Geobacillus sp. WCH70
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:gwc00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2687755..2688840)
Genome map
AA seq 361 aa AA seqDB search
MAKFDETLTMLKDLTDARGVPGNEREAREVMKKYIAPYADEVTTDGLGSLIAKKKGTDEG
PKIMIAGHLDEVGFMVTQIDDKGFIRFQTLGGWWSQVMLAQRVTILTRKGEITGVIGSKP
PHILPPEARKKPVEIKDMFIDIGATSREEAMEWGVRPGDSIVPYFEFTVLNNEKMLLAKA
WDNRIGCAIAIEVLKQLKDVDHPNVVYGVGTVQEEVGLRGARTAAHFIQPDIAFAVDVGI
AGDTPGVSEKEAMGKLGAGPHIVLYDATMVSHRGLREFVIDVAEELNIPYHFDAMPGGGT
DAGAIHLTASGVPSLTIAIPTRYIHSHAAILHRDDYENTVKLLVEVIKRLDAEKVKQITF
E
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaattcgatgaaacgttgacgatgctgaaggatttaaccgatgcgagaggcgtc
cctggaaatgaacgggaagcgcgcgaagtgatgaaaaagtacatagctccttacgccgat
gaagtaacgacagacggtcttggcagcttgattgcgaaaaagaaaggaacagacgaaggt
cctaaaattatgattgccggccatttggatgaagtcggctttatggtgacgcaaatcgat
gacaaaggatttatccgcttccaaacgctaggcggctggtggagccaagtcatgctagcg
cagcgtgtcaccattttaacgcgtaaaggagaaattaccggcgtcatcggttcgaaaccg
ccccacattttgccgccggaagcgcgcaaaaagccagtcgaaatcaaagatatgttcatc
gacatcggcgcgacaagccgggaagaagcaatggaatggggcgtgcgtccgggcgattcg
atcgttccgtattttgaatttaccgtgttgaacaatgaaaaaatgctgcttgcgaaagcc
tgggacaaccggatcggctgcgcgattgcgattgaggtattaaagcaattaaaagatgtc
gatcacccgaacgttgtctatggcgtcggcacggtgcaggaagaagtcggtttgcgcgga
gcgagaacggcggcgcatttcatccagccggatatcgcgtttgccgtggatgtcggcatt
gccggcgatacgccgggagtttccgaaaaagaagcgatgggcaagcttggcgctgggccg
catatcgtcttatacgacgcaacaatggtgtcgcatcgcggtttgcgcgaatttgtcatc
gatgttgccgaagaactcaacattccgtatcattttgatgcaatgccaggcggcggcact
gacgccggcgcgattcacttaacggcaagcggcgtgccgtcgctgacgatcgcgattcca
acgcgctacatccattcccatgcggcgattttgcaccgtgacgattacgaaaatacggta
aaattgcttgtcgaagtcatcaagcgcttagacgcggaaaaagtaaaacaaattacattc
gaataa

DBGET integrated database retrieval system