KEGG   Geobacillus sp. WCH70: GWCH70_2686Help
Entry
GWCH70_2686       CDS       T00915                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
gwc  Geobacillus sp. WCH70
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:gwc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    GWCH70_2686
   01230 Biosynthesis of amino acids
    GWCH70_2686
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GWCH70_2686
   00030 Pentose phosphate pathway
    GWCH70_2686
   00051 Fructose and mannose metabolism
    GWCH70_2686
   00052 Galactose metabolism
    GWCH70_2686
  Energy metabolism
   00680 Methane metabolism
    GWCH70_2686
Enzymes [BR:gwc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     GWCH70_2686
Protein phosphatases and associated proteins [BR:gwc01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     GWCH70_2686
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2718945..2719904)
Genome map
AA seq 319 aa AA seqDB search
MKRIGVLTSGGDSPGMNAAIRAVVRKAIYHGVEVFGIYYGYAGLIAGKIKKLEVGDVGDI
IHRGGTILYTARCPEFKTEEGQLKGIEQLKKHGIEGLVVIGGDGSYQGAKKLTEHGFPCV
GVPGTIDNDIPGTDFTIGFDTALNTVIDAIDKIRDTATSHERTYVIEVMGRHAGDIALWS
GLAGGAETILIPEADYDMNDVIARLKRGHERGKKHSIIIVAEGVGSGVEFGKKIQEATGF
ETRVTVLGHVQRGGSPTAFDRVLASRLGARAVELLLEGKGGRCVGIQNNQLVDHDIVEAL
ANKHTVDQKMYLLSKELSI
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtataggtgtgttaacaagtggcggagattcaccaggtatgaatgcagcgatt
cgcgctgtcgtccgtaaggcgatttatcatggagtagaagtatttggaatttattatggg
tatgctggcttgattgctgggaaaattaaaaaattagaagtaggggatgtcggcgatatt
atccatcgcggaggtacaatactgtatacggcgcgctgtccggaatttaagacagaagaa
gggcagttaaaagggattgaacaattgaaaaaacacgggattgaaggattagtcgtcatc
ggtggagatggttcttatcaaggtgccaaaaaattaacagagcacggatttccttgtgtc
ggggtgccaggaaccattgacaatgacattcctggaacagattttacgattggtttcgat
acggctttaaacacggtgattgacgcgattgacaaaattcgtgatactgctacatcgcat
gaacgaacatatgtgattgaagtaatggggcgtcatgctggggatattgcgttatggtca
gggcttgctggaggtgcagaaacgattttgattccagaagccgattacgatatgaatgat
gttattgcacggttaaagcgtggtcatgaacgaggcaaaaaacatagtattattatcgtt
gctgaaggtgtcggaagcggagtcgagtttggaaagaaaattcaagaagcgacaggattt
gaaacgcgcgtcacagtgttgggacatgttcagcgcggcggttctccaaccgcgtttgac
cgtgtgttagccagccgcttaggtgcacgggcagtagagctattgttagaaggcaaaggc
ggccgctgcgtcggcatccaaaataatcagcttgtcgaccatgatattgtggaagcatta
gcaaacaaacataccgttgaccaaaaaatgtatttgttatcgaaagagctatccatctag

DBGET integrated database retrieval system