KEGG   Geobacillus sp. WCH70: GWCH70_2772Help
Entry
GWCH70_2772       CDS       T00915                                 

Definition
alpha/beta hydrolase
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
gwc  Geobacillus sp. WCH70
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:gwc00564]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2807520..2808311)
Genome map
AA seq 263 aa AA seqDB search
MWKWEANEGKGTVVIVHGAAEHHGRYQWLIEQWVKSGYHVVAGDLPGQGRTTRRKRGHIQ
SFDEYINEVADWITEAKQFHVPVFLLGHSMGGLVVIRTLQEKRPSVQGVILSSPCLGLVS
YPSKGLDMLSRVLNYIAPSLLIDSGLSVELATRNKEVHETDKHDELYVTKVSVRWYRELV
KAMELAFRRIQKFPDIPLLLMQGGDDKIVDKTAVKEWFDRLPISEKMYKEWNKLYHEIFN
EPEREDVFLYAKSFLDTQCQLYR
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgtggaaatgggaggcaaatgaaggaaaaggaacggttgtgattgtccacggagccgcg
gagcaccacgggcgctatcaatggttgatcgagcagtgggtgaaaagcggttatcatgtt
gtagcaggagatttgcctggacaagggcggacaacgagaagaaaacgtggacatatccaa
tcgtttgatgaatatattaatgaggtggccgattggatcacggaagccaaacaatttcat
gtaccggtattccttcttggacatagcatgggagggcttgttgttatccgtacattgcaa
gaaaaacgcccttctgtacaaggggttattttatcttcgccatgtttaggacttgtatcg
tacccatcgaaagggcttgatatgttatcaagagtattaaattatatcgcgccatccctt
ttgatcgattcaggattgtctgtcgaactggcaacaagaaataaagaagtacatgagacg
gataaacatgatgagctttatgtgacgaaagtatctgtccgctggtatcgtgaattagta
aaggcgatggaattggcttttcgccgtattcagaaattccctgatatcccattgctgctc
atgcaaggcggggacgataaaattgtcgataaaacagctgtaaaagaatggtttgaccgt
ttgccgatatcggaaaaaatgtataaagaatggaacaaattatatcatgaaatttttaat
gaaccggagcgggaagatgttttcttatacgcaaaatcgtttttagatacacaatgccaa
ctatatcgctag

DBGET integrated database retrieval system