KEGG   Geobacillus sp. WCH70: GWCH70_2772Help
Entry
GWCH70_2772       CDS       T00915                                 

Definition
alpha/beta hydrolase
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
gwc  Geobacillus sp. WCH70
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:gwc00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    GWCH70_2772
Enzymes [BR:gwc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     GWCH70_2772
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2807520..2808311)
Genome map
AA seq 263 aa AA seqDB search
MWKWEANEGKGTVVIVHGAAEHHGRYQWLIEQWVKSGYHVVAGDLPGQGRTTRRKRGHIQ
SFDEYINEVADWITEAKQFHVPVFLLGHSMGGLVVIRTLQEKRPSVQGVILSSPCLGLVS
YPSKGLDMLSRVLNYIAPSLLIDSGLSVELATRNKEVHETDKHDELYVTKVSVRWYRELV
KAMELAFRRIQKFPDIPLLLMQGGDDKIVDKTAVKEWFDRLPISEKMYKEWNKLYHEIFN
EPEREDVFLYAKSFLDTQCQLYR
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgtggaaatgggaggcaaatgaaggaaaaggaacggttgtgattgtccacggagccgcg
gagcaccacgggcgctatcaatggttgatcgagcagtgggtgaaaagcggttatcatgtt
gtagcaggagatttgcctggacaagggcggacaacgagaagaaaacgtggacatatccaa
tcgtttgatgaatatattaatgaggtggccgattggatcacggaagccaaacaatttcat
gtaccggtattccttcttggacatagcatgggagggcttgttgttatccgtacattgcaa
gaaaaacgcccttctgtacaaggggttattttatcttcgccatgtttaggacttgtatcg
tacccatcgaaagggcttgatatgttatcaagagtattaaattatatcgcgccatccctt
ttgatcgattcaggattgtctgtcgaactggcaacaagaaataaagaagtacatgagacg
gataaacatgatgagctttatgtgacgaaagtatctgtccgctggtatcgtgaattagta
aaggcgatggaattggcttttcgccgtattcagaaattccctgatatcccattgctgctc
atgcaaggcggggacgataaaattgtcgataaaacagctgtaaaagaatggtttgaccgt
ttgccgatatcggaaaaaatgtataaagaatggaacaaattatatcatgaaatttttaat
gaaccggagcgggaagatgttttcttatacgcaaaatcgtttttagatacacaatgccaa
ctatatcgctag

  All links  
No link information was found.   
DBGET integrated database retrieval system