KEGG   Geobacillus sp. WCH70: GWCH70_2895Help
Entry
GWCH70_2895       CDS       T00915                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
gwc  Geobacillus sp. WCH70
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:gwc00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    GWCH70_2895
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    GWCH70_2895
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    GWCH70_2895
Enzymes [BR:gwc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     GWCH70_2895
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2923166..2924227)
Genome map
AA seq 353 aa AA seqDB search
MTWKGLLQAYGEFLPINENTPMLSLNEGNTPLIPLPRLSEKLDVELYVKVEGANPTGSFK
DRGMVMAVAKAKEAGSHTIICASTGNTSASAAAYAARAGLRCIVVIPNGKIAMGKLAQAV
MYGAEIFAIEGNFDEALKMVRRLSDIAPITLVNSVNPYRIEGQKTAAFEVCDQLGKAPDV
LAIPVGNAGNITAYWKGFKEYHAAKQTGLPQMRGFEAEGAAAIVRNQVIEHPETIATAIR
IGNPASWEKAVQAATESNGKIDEVSDAEILEAYKLLAREEGIFAEPASCASIAGVIKQRK
RNEIRKGSTVVAVLTGNGLKDPAIAMETAEIKPTVLPNDEAIVFEHIQGVVHQ
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgacatggaaagggctgttgcaggcgtacggtgaatttttgccaatcaatgaaaatacc
ccgatgctttctttaaacgaaggaaatacaccgcttattccgctgccacggctatcggaa
aagcttgatgtggaattgtacgtaaaagtggaaggcgcaaatccgacgggatcgtttaaa
gaccgcggcatggtgatggcggtcgcaaaggcgaaagaagcgggcagccatacgattatt
tgcgcttcgacaggcaatacgtccgcttctgctgcggcttacgcggcaagagcagggttg
cgctgtattgtcgtgattccgaatggcaaaattgcaatgggaaaactagcccaggcagtt
atgtacggagcagaaatttttgcgattgagggaaactttgatgaagcgttaaaaatggtg
cgccgccttagcgatatcgccccgattacccttgtcaactcggtaaatccatatcgtatc
gaggggcagaaaacagcggcattcgaggtttgcgaccagcttggcaaagcgccggatgtg
cttgcgattccggtcggcaatgccgggaatattaccgcttattggaagggatttaaagag
tatcatgcggcgaaacaaactggtcttccgcaaatgcgcggattcgaggcggagggagcg
gcggcgattgtccgcaatcaagtgattgagcatccggaaacgatcgcgacagcgattcgt
attggcaatccggcaagctgggaaaaagcggtgcaagcggcaacggaatcaaatggaaaa
atcgatgaagtatcggatgcggaaattttagaagcgtataaactgcttgcgcgggaggaa
ggaatttttgctgaacctgcttcttgcgcatccattgcgggagtgatcaagcaacggaag
cggaatgaaattagaaagggaagcaccgttgtggcggtgttgacaggaaatgggctgaaa
gatccggcaattgcgatggaaacagcggaaattaaaccaaccgtacttccgaatgatgag
gcgattgtgtttgagcatattcaaggagttgtccatcaatga

DBGET integrated database retrieval system