KEGG   Geobacillus sp. WCH70: GWCH70_2956Help
Entry
GWCH70_2956       CDS       T00915                                 

Definition
(GenBank) carboxylesterase
  KO
K03928  carboxylesterase [EC:3.1.1.1]
Organism
gwc  Geobacillus sp. WCH70
Brite
Enzymes [BR:gwc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     GWCH70_2956
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_6 BAAT_C DLH Peptidase_S9 DUF2048 PhoPQ_related UPF0227 DUF676 TMP_2 Chlorophyllase
Motif
Other DBs
NCBI-ProteinID: ACS25629
JGI: GWCH70_2956
UniProt: C5D7L9
Position
complement(2978777..2979517)
Genome map
AA seq 246 aa AA seqDB search
MKIVPPKPFFFEAGERAVLLLHGFTGNSSDVRMLGRFLESKGYTCHAPIYKGHGVPPEEL
VHTGPDDWWQDVMNAYEFLKNKGYEKIAVAGLSLGGVFSLKLGYTVPVVGIIPMCAPMYI
KSEETMYQGVLKYAREYKKREGKTPEQIEKEMEAFKKTPMKTLKALQQLIADVRDHIDLI
YAPTFVVQARHDEMINSDSANIIYNGIESPVKKIKWYEESGHVITLDKEKEQLHEDVYEF
LESLDW
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgaagatcgtcccaccaaagccatttttctttgaagcaggagaacgtgcggttttattg
ctccatggttttactggaaactcgtcggatgtaagaatgttaggccgttttcttgaatca
aaaggatatacatgccatgcgccgatttataaaggccatggggtgccgccagaagagctt
gtacataccggaccggatgactggtggcaagatgtcatgaacgcttatgaatttttaaaa
aataaaggatacgaaaaaatcgcagtggcaggattatcgcttggcggcgtattttccctt
aaattaggctacactgtacctgtagtgggaattattccaatgtgcgcgccgatgtatatt
aaaagcgaagaaacaatgtaccaaggtgtgctaaagtatgcgcgcgaatataaaaaacga
gaaggaaaaacaccggaacaaattgaaaaagaaatggaagcatttaaaaaaacgccgatg
aaaacgttaaaagcgttgcagcagcttattgcggatgtacgtgaccatatcgacttgatt
tatgcgccgacatttgtcgtgcaagcgcgtcacgatgaaatgattaactctgatagtgcc
aatattatttataacggtattgaatcaccagtgaaaaaaatcaaatggtatgaagaatcg
ggccatgtcattacgctagataaagaaaaagaacagttgcatgaagatgtttatgagttt
ttagagtcattggattggtaa

DBGET integrated database retrieval system