KEGG   Geobacillus sp. WCH70: GWCH70_2979Help
Entry
GWCH70_2979       CDS       T00915                                 

Gene name
hisD
Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
gwc  Geobacillus sp. WCH70
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:gwc01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:gwc00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2999898..3001166)
Genome map
AA seq 422 aa AA seqDB search
MKIERVTNRVSLRRTIESGTEEQRSKVLEIIADVRARGDEALKSYTEKFDGVRLDSLCVT
NEEIERAYQNVSAEVLRIIQEAAENIRDYHERQKRESWIMTKEDGTMLGQKITPLDAVGL
YVPGGTAAYPSSVLMNVIPAQVAGVKRIVITSPPNKDGTLPAGVLVAANELGVKEIYKVG
GAQAIAALAYGTETIRPVDKIFGPGNIYVALAKREVFGQVAIDMIAGPSEIVVLADETAK
ANEIAADLLSQAEHDERASAILVTPSMKLALAVAREVEKQLETLPRKAIASASLENYGAI
YVTETLAEAVEVVNELAPEHLEVMTAEPMQLLGQIRHAGAIFLGRFSSEPVGDYFAGPNH
VLPTNGTARFSSGLSVDEFVKKSSIIFYSEPALKQNAEKIAAFARLEGLEAHARAVEERF
KK
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaatcgaacgagtgacaaaccgtgtatcattgcgccgtacgattgaatcagggacg
gaagaacagcgcagtaaggttctggagattattgccgatgtgcgcgctcgcggtgatgaa
gcgctaaaaagttatacggaaaaattcgatggcgtccgccttgattcgctgtgcgtgaca
aacgaagaaatagaaagagcgtatcagaacgtaagcgcagaagtgcttcggatcatccaa
gaggcggcggaaaacattcgcgattatcatgagcgtcaaaagagagagtcatggatcatg
acaaaagaagacggcacgatgcttggtcagaaaataacgccgcttgatgcggttggattg
tacgttccaggagggacagccgcctacccgtcatcggtgcttatgaatgtcattcctgcc
caagtggcaggggtcaaacgaattgtgatcacctctccgccaaataaagacggaacgctt
ccggccggcgtgttagtggcggcgaacgaattaggagtgaaagaaatctataaagtcggc
ggtgcgcaggcgattgccgcgcttgcatacggaacggagacgattcgtccggtcgataaa
attttcgggccaggcaacatttacgtggcgctcgcgaaacgcgaagtgttcgggcaagtc
gcgattgatatgattgccggaccgagcgaaatcgtcgtgttggcggatgaaacggcaaag
gcgaacgaaattgccgctgatttgttgtcgcaagccgagcacgatgaacgcgcttccgcg
attctcgttactccatcgatgaaattggcgcttgcagtcgcacgcgaggtcgaaaaacag
ctggagacgctgccgcgcaaagcgattgcctctgcgtcgctcgagaactacggagccatt
tacgtcacagaaacgcttgcggaagcggtcgaagttgtgaatgaattagcaccggagcat
ttggaagtaatgacagccgaaccgatgcaactccttggtcaaatccgccatgcgggagcg
atttttttagggcgcttcagctcggagccggttggcgattacttcgccggtccaaaccat
gtgctgccgacgaatggtacagcccggttttcgagcggattaagcgtggatgaatttgtg
aaaaaatcgagcatcattttttacagcgagccggcgttaaagcaaaacgcggaaaaaatc
gcggcgtttgccagacttgaagggcttgaagcacatgcgcgcgccgttgaagaacgtttt
aaaaaataa

DBGET integrated database retrieval system