KEGG   Geobacillus sp. WCH70: GWCH70_3141Help
Entry
GWCH70_3141       CDS       T00915                                 

Definition
aspartate kinase (EC:2.7.2.4)
Orthology
K00928  
aspartate kinase [EC:2.7.2.4]
Organism
gwc  Geobacillus sp. WCH70
Pathway
Glycine, serine and threonine metabolism
Cysteine and methionine metabolism
Lysine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Methionine biosynthesis, apartate => homoserine => methionine
Threonine biosynthesis, aspartate => homoserine => threonine
Lysine biosynthesis, acetyl-DAP pathway, aspartate => lysine
Lysine biosynthesis, DAP aminotransferase pathway, aspartate => lysine
Class
Metabolism; Overview; 2-Oxocarboxylic acid metabolism [PATH:gwc01210]
Metabolism; Overview; Biosynthesis of amino acids [PATH:gwc01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:gwc00260]
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:gwc00270]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:gwc00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3168800..3170176)
Genome map
AA seq 458 aa AA seqDB search
MKVAKFGGSSVASATQFRKVADIVSSDVERRIIVVSAPGKRFKEDIKITDILIQLAQAVM
DGKACDEIVQAVVKRYAEIAKELELPADEFTAELEKDLRWKMNEYRHDPCRLMDAIKASG
EDHNARLMALYLQEIGLEASYVNPREAGIIVTDEPGNAQILPESYEKLYHLRKRRGVLVI
PGFFGYSPEGHIVTFPRGGSDITGSIVAAGVKADVYENFTDVDSIYCVNPSIVENPRQLK
EITYREMRELSYSGFSVFHDEALEPVYKAGIPVCVKNTNNPAAPGTWIVAKRNHHDEPIA
GIASDTGFCSINISKYLMNREIGFGRRLLQILEDEGISYEHTPSGIDNMSVILRENQLEG
GKEQRILDRIQTELEVDEVHIEHGLALIMVVGEGMERTVGMAAKATAALAKANINLEMIN
QGSSEVSMMFGVKEEVVADAVRALYEAYFQEASVGNEV
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtggcaaaatttggaggaagttcggtcgcaagcgccacacagtttcgaaaagtc
gccgatatcgtcagctctgatgtggagcgccgcattattgttgtatcggcgccggggaaa
cgatttaaagaggatataaaaataactgatatccttattcaattggcgcaagcggttatg
gacggaaaagcatgcgatgagatcgttcaggcggtagtaaaacgatatgcagaaatcgcc
aaggagctggaattaccggcagatgaatttacagcagagctagaaaaggatttgcgttgg
aaaatgaacgaatatcggcatgatccgtgccgcttgatggacgcgataaaagcgagcggg
gaagatcataacgctagattgatggcgctttatttacaggagatagggttagaagcaagc
tacgtcaatccgcgggaagcaggaattattgtaacggatgaaccgggtaatgcgcaaatt
ttgccggaatcgtatgaaaagctatatcatttacgaaaacgacgcggcgtattagtgatt
ccgggattttttggctactctcccgaagggcatattgtcacattcccgcgcggcggttca
gatattaccggatcgattgtagcagccggggtgaaagcggatgtgtatgaaaactttacg
gatgtcgattcgatttattgcgtcaatccttccattgtcgaaaacccacgccagttaaaa
gaaattacataccgagaaatgcgcgaactttcttattccggattttccgtgtttcatgac
gaagcgctggaaccagtttataaagcaggcattcctgtttgtgtgaaaaatacgaataac
cctgccgctccaggcacttggattgtcgccaaacgcaaccatcatgacgaaccgattgcc
ggcatcgctagtgatacgggattttgcagcattaacatcagcaaatatttaatgaaccgg
gaaatcggatttggccgcagactgctgcaaattctagaggatgaaggaatttcgtatgag
catactccttctggcattgacaacatgtccgttattttacgggaaaatcaattagaagga
ggaaaagagcagcgcattttagaccgcattcaaacggagctggaagtcgatgaagttcat
atcgaacatggacttgcgctgattatggtggttggcgaaggcatggaacgcaccgtcggg
atggcggcaaaagcaactgcggcgcttgcgaaggcaaacattaaccttgaaatgatcaac
caaggttcatcggaagtaagcatgatgttcggcgtaaaagaagaagtcgtggccgatgcg
gttcgcgcgctttatgaagcgtattttcaagaggcttccgtaggaaacgaagtataa

DBGET integrated database retrieval system