KEGG   Geobacillus sp. WCH70: GWCH70_3268Help
Entry
GWCH70_3268       CDS       T00915                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
gwc  Geobacillus sp. WCH70
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:gwc00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    GWCH70_3268
   00052 Galactose metabolism
    GWCH70_3268
   00500 Starch and sucrose metabolism
    GWCH70_3268
   00520 Amino sugar and nucleotide sugar metabolism
    GWCH70_3268
Enzymes [BR:gwc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     GWCH70_3268
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3296618..3297508)
Genome map
AA seq 296 aa AA seqDB search
MKKVRKAIIPAAGLGTRFLPATKAMPKEMLPIVDKPTIQYIVEEAIASGIEDIIIVTGKG
KRAIEDHFDNAYELEQILMKQGKLDLLEKVKEPSKVDIHYIRQKEPKGLGHAVWCARNFI
GDEPFAVLLGDDIVQAETPCLKQLIDQYEQTFSSVIGVKRVPDEETHRYGIIDPLEQHGR
RYQVRQFVEKPAPGTAPSNLAIMGRYILTPEIFLFLEKQEAGAGGEIQLTDAIQKLNEIQ
RVFAYEFEGKRYDVGEKLGFIQTTIEFALQNEELRDDLLAFMEKIVTETKQNTNAS
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaaaagtacgcaaagcgatcatcccggcggcggggctcggcacaagatttttgccg
gcgacgaaagcgatgccgaaagaaatgctcccgatcgtcgataaaccaacaattcaatac
atcgtcgaagaagcgatcgcatccggcatcgaagatattatcatcgtcacagggaaagga
aaacgcgcgatcgaggaccatttcgacaacgcctatgaactggaacaaatattaatgaaa
caagggaaactagacttgctagaaaaagtaaaagagccatcaaaagtcgatattcactac
atccgtcaaaaagaaccgaaaggacttggccacgccgtttggtgtgcgcgcaactttatc
ggtgacgaaccattcgccgttttgcttggcgatgacatcgtccaagcggaaacgccgtgc
ttaaaacaattaatcgaccaatatgaacaaacatttagctcggtcatcggcgttaaacgg
gtgcctgatgaggaaacacaccgctacggcattatcgatccactcgaacaacacggccgc
cgctaccaagttcgccaattcgtcgaaaaaccagcaccaggcaccgcgccatcgaactta
gcgattatggggagatacatactcacaccggaaatcttcttattccttgaaaaacaagaa
gctggcgctggcggggaaattcagcttaccgacgcgatccaaaagctgaacgaaattcaa
cgtgtgtttgcctacgaatttgaaggcaagcgctatgacgtcggcgagaagctcggattt
atccaaacgacgattgagtttgcgttgcagaatgaggagttaagagacgatttactcgca
tttatggagaaaatcgttacggaaacaaaacaaaatacgaatgcatcataa

DBGET integrated database retrieval system