KEGG   Geobacillus sp. WCH70: GWCH70_3268Help
Entry
GWCH70_3268       CDS       T00915                                 

Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
gwc  Geobacillus sp. WCH70
Pathway
gwc00040  Pentose and glucuronate interconversions
gwc00052  Galactose metabolism
gwc00500  Starch and sucrose metabolism
gwc00520  Amino sugar and nucleotide sugar metabolism
gwc01100  Metabolic pathways
gwc01130  Biosynthesis of antibiotics
Module
gwc_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:gwc00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    GWCH70_3268
   00052 Galactose metabolism
    GWCH70_3268
   00500 Starch and sucrose metabolism
    GWCH70_3268
   00520 Amino sugar and nucleotide sugar metabolism
    GWCH70_3268
Enzymes [BR:gwc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     GWCH70_3268
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Glycos_transf_2 IspD CTP_transf_3
Motif
Other DBs
NCBI-ProteinID: ACS25909
JGI: GWCH70_3268
UniProt: C5D956
Position
complement(3296618..3297508)
Genome map
AA seq 296 aa AA seqDB search
MKKVRKAIIPAAGLGTRFLPATKAMPKEMLPIVDKPTIQYIVEEAIASGIEDIIIVTGKG
KRAIEDHFDNAYELEQILMKQGKLDLLEKVKEPSKVDIHYIRQKEPKGLGHAVWCARNFI
GDEPFAVLLGDDIVQAETPCLKQLIDQYEQTFSSVIGVKRVPDEETHRYGIIDPLEQHGR
RYQVRQFVEKPAPGTAPSNLAIMGRYILTPEIFLFLEKQEAGAGGEIQLTDAIQKLNEIQ
RVFAYEFEGKRYDVGEKLGFIQTTIEFALQNEELRDDLLAFMEKIVTETKQNTNAS
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaaaagtacgcaaagcgatcatcccggcggcggggctcggcacaagatttttgccg
gcgacgaaagcgatgccgaaagaaatgctcccgatcgtcgataaaccaacaattcaatac
atcgtcgaagaagcgatcgcatccggcatcgaagatattatcatcgtcacagggaaagga
aaacgcgcgatcgaggaccatttcgacaacgcctatgaactggaacaaatattaatgaaa
caagggaaactagacttgctagaaaaagtaaaagagccatcaaaagtcgatattcactac
atccgtcaaaaagaaccgaaaggacttggccacgccgtttggtgtgcgcgcaactttatc
ggtgacgaaccattcgccgttttgcttggcgatgacatcgtccaagcggaaacgccgtgc
ttaaaacaattaatcgaccaatatgaacaaacatttagctcggtcatcggcgttaaacgg
gtgcctgatgaggaaacacaccgctacggcattatcgatccactcgaacaacacggccgc
cgctaccaagttcgccaattcgtcgaaaaaccagcaccaggcaccgcgccatcgaactta
gcgattatggggagatacatactcacaccggaaatcttcttattccttgaaaaacaagaa
gctggcgctggcggggaaattcagcttaccgacgcgatccaaaagctgaacgaaattcaa
cgtgtgtttgcctacgaatttgaaggcaagcgctatgacgtcggcgagaagctcggattt
atccaaacgacgattgagtttgcgttgcagaatgaggagttaagagacgatttactcgca
tttatggagaaaatcgttacggaaacaaaacaaaatacgaatgcatcataa

DBGET integrated database retrieval system