KEGG   Komagataeibacter medellinensis: GLX_00330Help
Entry
GLX_00330         CDS       T01631                                 

Definition
(GenBank) succinyl-CoA synthetase beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
gxy  Komagataeibacter medellinensis
Pathway
gxy00020  Citrate cycle (TCA cycle)
gxy00640  Propanoate metabolism
gxy00660  C5-Branched dibasic acid metabolism
gxy01100  Metabolic pathways
gxy01110  Biosynthesis of secondary metabolites
gxy01120  Microbial metabolism in diverse environments
gxy01130  Biosynthesis of antibiotics
gxy01200  Carbon metabolism
Module
gxy_M00009  Citrate cycle (TCA cycle, Krebs cycle)
gxy_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:gxy00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    GLX_00330
   00640 Propanoate metabolism
    GLX_00330
   00660 C5-Branched dibasic acid metabolism
    GLX_00330
Enzymes [BR:gxy01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     GLX_00330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A
Motif
Other DBs
NCBI-ProteinID: BAK82445
UniProt: G2I229
Position
complement(37771..38970)
Genome map
AA seq 399 aa AA seqDB search
MNIHEYQAKALLRSYGMPVPEGRAATSAAQALDAARSLAAPVTVVKAQIHAGGRGAGHFA
SNPEGRGGVRLARSLDEVSEAAGAMLGEILVTKQTGPAGRMVRTLYIESGCDIARELYFS
MLVDRVSGQIVIVASPDGGMEIEEVAARTPERILKEYIDPAKGLCDYQSRDLAVRLGLTG
REIRAFQNIVRSAYNAFTDLDAAIVEINPLVVTGAGDLLALDAKMSFDENALFRHPELAK
LRDEHEEDPREREAAGYGLAYVGLDGNIGCMVNGAGLAMATMDIIKMEGEEPANFLDVGG
GASKERVAAAFRILIGDPKVRGILVNIFGGIMRCDVIAEAIIAASHETGLNVPLVVRLAG
TNVERGKALLAESGLTIIPADDLGDAARKIVSAVRHAGA
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgaatattcacgaatatcaggcaaaggcgctgctgcgctcctacggcatgcccgtgcct
gaaggccgtgccgccacctccgcagcgcaagccctggatgccgcccgtagccttgctgcg
cccgttacggtggtcaaggctcagatccatgcgggcggacgtggtgcggggcattttgcc
agcaaccccgaaggcaggggcggcgtgcgcctggcccgcagccttgatgaggtgagtgag
gccgccggggccatgctgggtgaaatactggtcaccaaacagaccgggcccgcgggtcgc
atggtccgcacgctgtatatcgagtccggctgcgacatcgcgcgcgaactgtatttctcc
atgctggtggaccgggtaagcggccagatcgtcattgttgcctcccctgatggcggcatg
gagatcgaggaagtcgcggcgcgcacgcccgaacgtatcctcaaggaatatatcgaccct
gcgaagggcctgtgtgattaccagtcacgtgaccttgccgtgcgtcttggcctgacaggg
cgcgagatcagagcgttccagaacatcgtgcgttccgcctataacgcctttaccgacctg
gatgccgcgattgtggagatcaatccgctggtggtgaccggggcgggcgacctgctggcg
ctggacgccaagatgtcgttcgatgaaaacgcgctgttccgccaccccgaactggcaaag
ctgcgtgatgagcacgaagaagacccgcgtgagcgcgaagccgccggatacgggctggcc
tatgtcggcctggacggcaatatcggctgtatggtcaatggcgcgggtctggccatggcg
acgatggacatcatcaagatggaaggcgaggagccggccaacttccttgatgtgggtggt
ggcgcatcgaaagagcgcgtggcggcggccttccgcatcctgatcggcgaccccaaggtg
cgcggcatccttgtcaacatcttcggtggaatcatgcgctgcgacgtgattgcggaagcc
atcatcgccgcctcgcacgagacggggctgaatgtgcccctggtggtgcgcctggcgggc
acgaatgtcgaacgcggcaaggcgcttctggctgaatccggcctgaccatcatccccgcc
gatgatctgggcgatgccgcccgcaagatcgtatccgccgtccgtcatgcgggagcctga

DBGET integrated database retrieval system