KEGG   Gluconacetobacter medellinensis NBRC 3288: GLX_00330Help
Entry
GLX_00330         CDS       T01631                                 

Definition
succinyl-CoA synthetase subunit beta
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
gxy  Gluconacetobacter medellinensis NBRC 3288
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:gxy00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    GLX_00330
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    GLX_00330
   00640 Propanoate metabolism
    GLX_00330
   00660 C5-Branched dibasic acid metabolism
    GLX_00330
Enzymes [BR:gxy01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     GLX_00330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(37771..38970)
Genome map
AA seq 399 aa AA seqDB search
MNIHEYQAKALLRSYGMPVPEGRAATSAAQALDAARSLAAPVTVVKAQIHAGGRGAGHFA
SNPEGRGGVRLARSLDEVSEAAGAMLGEILVTKQTGPAGRMVRTLYIESGCDIARELYFS
MLVDRVSGQIVIVASPDGGMEIEEVAARTPERILKEYIDPAKGLCDYQSRDLAVRLGLTG
REIRAFQNIVRSAYNAFTDLDAAIVEINPLVVTGAGDLLALDAKMSFDENALFRHPELAK
LRDEHEEDPREREAAGYGLAYVGLDGNIGCMVNGAGLAMATMDIIKMEGEEPANFLDVGG
GASKERVAAAFRILIGDPKVRGILVNIFGGIMRCDVIAEAIIAASHETGLNVPLVVRLAG
TNVERGKALLAESGLTIIPADDLGDAARKIVSAVRHAGA
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgaatattcacgaatatcaggcaaaggcgctgctgcgctcctacggcatgcccgtgcct
gaaggccgtgccgccacctccgcagcgcaagccctggatgccgcccgtagccttgctgcg
cccgttacggtggtcaaggctcagatccatgcgggcggacgtggtgcggggcattttgcc
agcaaccccgaaggcaggggcggcgtgcgcctggcccgcagccttgatgaggtgagtgag
gccgccggggccatgctgggtgaaatactggtcaccaaacagaccgggcccgcgggtcgc
atggtccgcacgctgtatatcgagtccggctgcgacatcgcgcgcgaactgtatttctcc
atgctggtggaccgggtaagcggccagatcgtcattgttgcctcccctgatggcggcatg
gagatcgaggaagtcgcggcgcgcacgcccgaacgtatcctcaaggaatatatcgaccct
gcgaagggcctgtgtgattaccagtcacgtgaccttgccgtgcgtcttggcctgacaggg
cgcgagatcagagcgttccagaacatcgtgcgttccgcctataacgcctttaccgacctg
gatgccgcgattgtggagatcaatccgctggtggtgaccggggcgggcgacctgctggcg
ctggacgccaagatgtcgttcgatgaaaacgcgctgttccgccaccccgaactggcaaag
ctgcgtgatgagcacgaagaagacccgcgtgagcgcgaagccgccggatacgggctggcc
tatgtcggcctggacggcaatatcggctgtatggtcaatggcgcgggtctggccatggcg
acgatggacatcatcaagatggaaggcgaggagccggccaacttccttgatgtgggtggt
ggcgcatcgaaagagcgcgtggcggcggccttccgcatcctgatcggcgaccccaaggtg
cgcggcatccttgtcaacatcttcggtggaatcatgcgctgcgacgtgattgcggaagcc
atcatcgccgcctcgcacgagacggggctgaatgtgcccctggtggtgcgcctggcgggc
acgaatgtcgaacgcggcaaggcgcttctggctgaatccggcctgaccatcatccccgcc
gatgatctgggcgatgccgcccgcaagatcgtatccgccgtccgtcatgcgggagcctga

DBGET integrated database retrieval system