KEGG   Gluconacetobacter medellinensis NBRC 3288: GLX_01470Help
Entry
GLX_01470         CDS       T01631                                 

Definition
glycogen branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
gxy  Gluconacetobacter medellinensis NBRC 3288
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gxy00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    GLX_01470
Enzymes [BR:gxy01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     GLX_01470
Exosome [BR:gxy04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   GLX_01470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
165778..167997
Genome map
AA seq 739 aa AA seqDB search
MRIRQDEAHYHLPPGVDDLVHGRSSDPFSILGRHNMGKVDVVRVMYHDAARVRLVIERAR
GGAVERPMRRMGDTGLHIGTIAAGARYHLKITWADAVEETGDPYSFGLLLDEETLRLFSE
GRHAMLDRVMGAQPMVMEGMPGVRFAVWAPHARRVSVIGDFNFWDGRRHPMRLRHEAGVW
ELFIPGLVAGERYKFEILTREGHILPQKADPYARFAERPPATASVIAPAEDFAWSDGEWM
ARRGALQAHDAPLSIYELHVPSWRRPQGDPARIMSWRELARELIPYVLGAGFTHVELMPV
MEYPFGGSWGYQPLGLFAPSARHGTPADFASFVDACHGAGIGVILDWVPAHFPNDVHGLV
CFDGCALYEHQDPREGVHRDWNTHIYNLGRHEVRGFLIASALMWLRRYHIDGLRVDAVAS
MLYRDYSRREGEWIPNIHGGRENLEAVAFLRQLNETVRATVPDAMMIAEESTAWSGVTRP
VEYGGLGFSYKWNMGWMHDSLRFFARDPLWRGFYLQDILFGLHYAFSEHFILCISHDEVT
HGKGSLLARMPGDDWQRHANMRLYFAFMWAHPGRKLIFMGTEFGQEGEWSHDGEPDWSSL
VAPFKSGVAALVADLNHVYRTLPALHALDSDPAGFAWVIGDDTVNTVLSWLRLAPGHPPV
LVVLNLTPVPRHGYRVGVPVGGLWRECLNSDAASYGGSGVGNGGAVMATDQAAHGQPCSC
VLTLPPLAALYLHPAGDGA
NT seq 2220 nt NT seq  +upstreamnt  +downstreamnt
atgaggatcagacaggatgaagcccattaccacctgccccccggcgtggacgatcttgtg
catggccgcagttccgatccgttttccattcttggtcgccacaacatgggcaaggtcgat
gtcgtccgtgtgatgtatcatgacgcagcgcgtgtgcgcttggtgatcgaacgcgcgcgt
ggtggcgcggtggaacgccccatgcgccgcatgggggatacggggctgcatatcggtacg
attgccgcaggggcgcgctaccacctgaaaattacctgggcggatgcggtggaagagacg
ggagacccctattccttcggtctgctgctggatgaggagacgctgcgcctgttctccgaa
gggcggcatgcgatgctggatcgtgtgatgggggcacaacccatggtgatggagggcatg
cccggcgtacgttttgccgtatgggcgccgcatgcgcggcgggtgtcggtgatcggggac
ttcaatttctgggatggccgacgccaccccatgcgcctgcggcacgaagcgggggtgtgg
gaactgttcattcccggccttgttgcgggcgagcgctacaagttcgagatcctgacgcgt
gaggggcatatcctgccccagaaggcggatccctatgcccgctttgccgagcgcccgccc
gctacggcctccgttattgcgccggcggaagactttgcctggtccgatggggaatggatg
gcccgccgtggcgcgctgcaggcacatgatgcgccactgtccatatacgaactgcatgtc
ccttcgtggcgcaggccacagggggaccctgcgcggatcatgtcatggcgcgaactggcg
cgtgaattgatcccttatgtgctgggtgcgggttttacgcatgtggaactgatgccagtc
atggaatatccgtttggcgggtcgtggggctaccagccgctggggctattcgcaccctct
gcccgacatggcacgccagcggatttcgcaagctttgtcgatgcctgccacggtgctggc
atcggtgtgatactggactgggtgccagcacattttcccaatgatgtgcacgggctggtc
tgttttgatggctgcgcactgtacgaacaccaggacccgcgtgaaggcgtacaccgggac
tggaacacccatatctacaaccttggacggcacgaggtacggggtttcctgattgccagc
gcgctcatgtggctgcggcgctaccatattgacggtttgcgggtcgatgccgtggcctcc
atgctgtaccgtgactacagccgcagggaaggggagtggatacccaacatccatggtggg
cgtgaaaaccttgaagccgtggcgttcctgcgccagttgaacgagaccgtgcgcgccacc
gtgcccgatgccatgatgattgccgaggaatcaaccgcctggtccggcgtgacccgcccg
gtggaatatggcggccttgggttttcctacaaatggaacatgggctggatgcatgacagc
ctgcgctttttcgcgcgcgatccgctgtggcggggcttttatttgcaggatatcctgttc
ggccttcactatgcgttcagcgagcacttcatcctgtgcatatcgcatgatgaagtcacg
cacggcaaaggctcgctgctggcgcgcatgcccggtgatgactggcagcgacatgccaac
atgcggttgtacttcgctttcatgtgggcgcatccggggcgcaagctcatcttcatgggc
accgagttcgggcaggaaggtgaatggtcgcatgatggcgagccggactggtccagcctt
gtggcaccgttcaagtcaggggttgcagcgcttgtggccgacctgaaccatgtctaccgc
acgctgcctgcactccacgcgctggatagtgaccccgccgggtttgcctgggtcattggt
gatgacacggtcaacacggtcctgtcctggctgcgccttgcccccggccacccgccggtt
ctggtcgtgctcaacctgactcctgtcccccggcatggctatcgggtgggcgtaccggtg
ggcggcctgtggcgcgaatgcctcaattccgatgccgcttcctacggtggcagcggcgtg
ggtaatggcggcgcggtcatggcaacggatcaggccgcccatgggcagccgtgttcgtgc
gtgctgacactgccgccacttgcagcgctgtatctccacccggcgggggatggggcatga

DBGET integrated database retrieval system