KEGG   Gluconacetobacter medellinensis NBRC 3288: GLX_01500Help
Entry
GLX_01500         CDS       T01631                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
gxy  Gluconacetobacter medellinensis NBRC 3288
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gxy00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    GLX_01500
Enzymes [BR:gxy01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     GLX_01500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
171885..173978
Genome map
AA seq 697 aa AA seqDB search
MNNRDLADRARRAGLSVRWRDAAGQIHRVSNDSIRRLLTVMENHGGTDRSPANLPAMVVA
VAGQATILPNMGADAPATFRLVMEDGSRLEGQLRQLRGRLVLPALTRCGYHRLEIGSAHT
TLALSPPACPSIASRTTGGPVRPWGVGVQIHGLHMPGDGGIGHFGALGGLARTTAGKGAD
VLAISPVHAMFAARPGQYSPYSPSSRLFLNPLLGDPHAVFDTATIQRAEVRQGREWMATL
RALEHAPLIEWEQATAHRYRLLRQLYEDRIAASPPDDLLTFRHAGGRALEQHAIFETLHA
HFTTRGARGGDWRCWPQAMRLPDSPEVARFAAAFAHDVGFHVFMQWLAARSLAQAGTAAR
NAGMRIGLIADMAVGVDPTGSECWARQDQFLMGAAIGAPPDMLSPLGQDWGLTTFSPHGL
KASGYRAFIDTLRAGFAHGGGLRIDHVMALERLWVIPQGGTSAEGAYLSFPVRDLMRLVA
LEATRANAVVIGEDLGTVTTTFRKAAKKQGIMGMNVLFFERTAQGAYKSPAAWSRNAVAM
TTTHDLATVAGWWQGIDLEWRIRLGQMAPGVDAASLQATREYDRAMLWAALVAASARRLR
SLRAGRLAETPPPTPAGAAVVVDEAISLVARTPCPLAVIALEDLLGLAEQPNLPGTTTGH
PNWRRRYPGTVATVMSGADVRRRINRLRAGRGGNGHE
NT seq 2094 nt NT seq  +upstreamnt  +downstreamnt
atgaataatcgtgacctggccgatcgtgcccgccgggccgggctgagcgtgcgctggcgg
gatgctgccgggcagatccaccgggtctccaacgacagtatccgtcgcctactgaccgtg
atggaaaaccatggcggaacagatcgcagccccgccaatctgcccgctatggttgtggcg
gtggcggggcaggcgaccatcctgccgaatatgggtgcagatgccccggccacgttccgc
cttgtcatggaagatggcagtcgtcttgaaggtcagctaaggcagttacgaggccgtctg
gtgctgcctgccctgactcgttgcggctatcatcggctggaaatcggcagtgcgcatacc
acgctggctctttctccccctgcatgccccagcattgcatcgcgcacgacgggtggcccg
gtgcggccatggggcgtgggggtgcagatccatggtttgcacatgcctggtgatgggggg
atcggccattttggcgcgctaggcggccttgcgcgtacgacggcgggcaagggggcggat
gtgctggccataagcccggtgcatgccatgttcgcggcacggccggggcagtacagcccg
tattccccttcatcacggctgttcctcaacccgctgctgggtgacccgcatgcggtattc
gatactgcaacgatacagagggcggaggtgcggcagggccgtgagtggatggccaccctg
cgcgcgctggaacatgcgcccctgatcgaatgggagcaggccactgcccatcgctaccgc
ctgctgcgccagttatatgaagaccggattgccgcttctccccccgatgacctgctgacc
ttccgccatgctggcggcagggcgctggagcagcatgccatattcgagaccctgcatgcc
cattttaccacccgtggtgcgcgtgggggggactggcggtgctggccgcaggccatgcgc
ctgcctgacagccccgaagtggcccgttttgcggcagctttcgcccatgatgtaggcttt
catgtattcatgcagtggcttgccgcccgtagcttggcgcaggctggcacggctgcccgg
aacgccggcatgcggatcggcctgattgccgacatggcggtgggtgtggaccccacggga
agtgaatgctgggcacggcaggatcagttcctgatgggggcagccattggcgcaccgccc
gacatgctcagcccgctggggcaggactgggggctgaccaccttttccccccatgggctg
aaggccagcggctaccgggcctttatcgatactctgcgcgcgggttttgcccatggcgga
ggcctgcgtattgaccatgtcatggcgctggagcggttatgggtcataccgcagggcggc
acctcggctgaaggggcttacctgtcctttcccgtgcgtgacctcatgcggcttgtggcg
ctggaggcgacaagggccaatgccgtcgtgattggtgaagatctgggcacggtgaccact
acctttcgcaaggcagcaaaaaagcagggcataatgggcatgaacgtactgttttttgaa
cgtacggcgcagggtgcgtacaagtcacccgctgcgtggtcacgtaatgcggtggccatg
accactacgcacgatctggccacggttgcgggttggtggcaggggatcgacctggaatgg
cggatcaggctggggcagatggccccgggtgtggatgcggccagcctgcaggccacgcgt
gaatacgaccgcgccatgttatgggccgcccttgtggcagcaagcgcgcgtcgcttacgc
agcctgcgggcagggcggctggcggaaacgccgcccccaacccccgccggggcggctgtg
gtggtggatgaggcgatcagccttgttgcccgcaccccatgcccgctggcggtcattgcg
ctggaagacctgcttggcctggctgaacagcccaatctgccgggcaccaccacgggccac
cccaactggcgcaggcgttatcccggcacggtggccaccgtaatgtcgggtgccgatgtg
cgccggcgcatcaatcgcctgcgcgcggggcgtgggggcaatggccatgaatag

DBGET integrated database retrieval system