KEGG   Gluconacetobacter xylinus: GLX_02110Help
Entry
GLX_02110         CDS       T01631                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
gxy  Gluconacetobacter xylinus
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:gxy00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(245777..247276)
Genome map
AA seq 499 aa AA seqDB search
MAEYVGAIDQGTTSSRFMIFDRKGTVVSVAQKEHRQIYPQPGWVEHDPIEILENTNEMIG
AAMARANLGATSLVSVGITNQRETAVLWDRTTGLPLHNAIVWQDTRVDQLVREYGSDGGQ
DRFRAITGLPLASYFAGLKLRWLLDNVEGARQKAESGQALFGTVDSWLSWNLTGGVNGGI
HITDVTNASRTQLMNLRTCAWDEDMLRAFSIPAACLPRIVPSSQVYGTITIPSLQGTKLA
GILGDQQAALVGQTCFSPGEAKNTYGTGSFLLMNTGTDPVQSKAGLLTTVAYQFGMEEPR
YALEGSIAITGALVQWLRDNLKLFDLATQIEPLARSVADNGGIYIVPAFSGLYAPYWKEN
ARGTIVGLTRYVTRAHFARATLEATAYQVRDVVAAMEEDSGIVLTSLKTDGGMVANELLM
QFQADILNVPVVRPKVVETTALGAAYAAGLAVGYWENIDDLRANWVVDHTWQPTMPAEQR
SRYLGWWKKAVQKSFDWAE
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atggcggaatacgttggcgcgatagaccagggcacgaccagttcccggtttatgatattc
gaccgcaaggggaccgtggtttccgttgcgcagaaggagcaccgacaaatctatccccag
cccggctgggtcgaacatgatcccatcgaaattcttgaaaacacgaatgaaatgattggc
gctgccatggcgcgcgccaatctgggggcgaccagcctggtatcggtcggcataaccaac
cagcgcgaaaccgccgtgctatgggacaggacaaccggcctgccgctgcataacgccatt
gtctggcaggatacccgtgtagaccaactggtcagggaatatggcagcgatggcgggcag
gaccgcttccgcgccattaccggactgccgctggcaagctacttcgcggggctgaaactg
cgctggctgctcgataacgtggaaggcgcgcgccagaaggccgaaagcggacaggcgcta
ttcggcacggtagatagctggctttcatggaacctgaccggcggggtcaacggcggcatc
cacatcaccgacgtgaccaatgcctcgcgcacccaactcatgaacctcagaacctgtgcg
tgggatgaggacatgctgcgtgccttttccattcccgccgcctgcctgccccgtatcgtg
ccgtcttcgcaggtgtacggcacgatcacgatccccagcctgcagggtacgaaacttgcc
ggcattctgggcgaccagcaggcggctctggtcgggcaaacctgtttttcgccgggggaa
gccaagaacacctatggcaccggctcgttcctgctgatgaacaccggcaccgacccggtc
cagtcaaaggcagggctgctgacaacggtggcttaccagttcggtatggaagaaccgcgt
tacgcgctggaaggctccattgccattacgggcgcgctggtgcagtggctacgcgataac
ctgaaactgtttgacctggccacacagatcgaaccgctggcacgcagcgttgctgataat
ggcgggatctacatcgtgcccgccttttccggactgtatgcgccttactggaaggaaaat
gcgcgtggcaccattgtcgggctgacccgctatgtcacgcgcgcgcattttgcacgcgca
acactggaggccacggcctatcaggtccgcgatgtcgtggccgccatggaggaagacagc
ggcatcgttctgaccagcctgaaaaccgatggcggcatggtggcgaacgaactgctcatg
cagttccaggccgatatcctcaacgtaccggtcgtgcgccccaaggtggtggaaaccacg
gcgctgggtgcagcctacgccgcgggcctggccgtgggatactgggaaaacattgatgac
ctacgtgcaaactgggtggtggaccatacctggcagcccaccatgcccgcggagcagcgc
agccgctacctggggtggtggaagaaagccgtacagaaatcctttgactgggcggaatga

DBGET integrated database retrieval system