KEGG   Gluconacetobacter medellinensis NBRC 3288: GLX_02860Help
Entry
GLX_02860         CDS       T01631                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
gxy  Gluconacetobacter medellinensis NBRC 3288
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gxy00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    GLX_02860
Enzymes [BR:gxy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     GLX_02860
Exosome [BR:gxy04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   GLX_02860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
339383..340882
Genome map
AA seq 499 aa AA seqDB search
MNKKNRILAIDQGTTSTRSIVFDRDIAALSVARVEFAQHYPNQGWVEHDPEEIWSNVLST
AREAIEKVGGPATIAGIGITNQRETIVVWDRKTGKPIHRAIVWQDRRTTPVCMRMHEQGH
EPLVRERTGLLLDPYFSATKIAWILDNVDGARARAERGELACGTIDSFLLWRLTGGRVHA
TDMTNASRTLLFNIHTCMWDDELLALFNVPRAILPEVRTNSEIFGETEADLFGEPLKVAG
MAGDQNAAMVGQACFKPGTAKATYGTGCFALLNTGTTPVKSENRMLTTIAYRIGKETVYA
LEGSIFVAGAAIRWLRDGLGLITHASQTDDMATRVPHSHGVYMVPGFVGLGAPHWDPDAR
GLICGMTLGSTAAHIARAALESVAYQTLDLMEAMREDGGGRLNALRVDGGMSVNDWFCQF
LADMLQTPVERPQQVETTALGAAFLAGLATGVWGSISELEGTWTRGRLFRPTMDKEQRDS
MVAGWRLAVRRTLSSTVAA
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgaacaagaagaacagaattctcgctattgatcagggaacaacctccacccgcagcatc
gtgtttgaccgcgatatcgcggccctgtctgttgcccgtgttgaatttgcccagcattat
cccaatcagggctgggtagagcacgacccggaggaaatctggtccaatgtgctctccacg
gcacgcgaagccattgaaaaggttggggggcctgccaccatcgccggtattggcattacc
aatcagcgcgagaccattgtcgtatgggaccgcaagaccggcaagcccattcatcgcgcc
atcgtatggcaggatcgccgcaccacgccggtctgcatgcgcatgcatgagcaggggcat
gaacccctggtgcgcgagcgcaccgggctgctgctcgatccctatttttccgccaccaaa
attgcctggattctggataatgtggacggcgcgcgtgcgcgcgccgaacggggcgaactg
gcttgcggcaccatcgacagtttcctgctatggcggctgacgggtggccgcgtgcatgca
accgatatgaccaacgcatcacgcacgcttctgttcaacatccatacctgcatgtgggat
gatgaactgctcgccctgttcaacgtgccgcgcgctatcctccccgaagtccgtaccaac
agcgagatctttggcgagacggaagccgacctgtttggcgaaccgctgaaagtggccggc
atggcaggcgaccagaacgccgccatggtcggccaggcctgtttcaagcccggcaccgcc
aaggccacctatggcacgggctgctttgccctgctcaataccggcactacacccgtcaag
tcagaaaaccgcatgctgacgaccatcgcctatcgtattggtaaggagacggtctatgca
ctggaaggctcgatcttcgtggctggtgccgccatccgctggctgcgcgacgggctgggc
ctgattacccatgcctcccagactgatgacatggcgacccgcgtgccgcatagccatggc
gtgtacatggtccccggctttgtggggctgggcgcgccgcactgggaccccgatgcccgt
ggcctgatctgtggcatgacacttggttcaactgccgcgcatattgcccgcgcggcgttg
gagtcggtggcctaccagacgctggacctgatggaagccatgcgcgaggatggcggtggc
aggctgaacgcactgcgtgttgatggcggcatgtctgtcaatgactggttttgccagttc
ctggccgatatgctccagaccccggtggaacgcccccagcaggtcgagacgaccgcgctg
ggcgctgccttcctggcgggactggccacgggtgtgtggggcagcatttccgaactggag
ggcacctggacacgcgggcgcctgttccgcccgacgatggacaaggagcagcgcgatagt
atggttgcgggctggcgtctggcggtgcgccgcaccctcagttccaccgtagccgcctga

DBGET integrated database retrieval system