KEGG   Gluconacetobacter medellinensis NBRC 3288: GLX_03340Help
Entry
GLX_03340         CDS       T01631                                 

Gene name
mauG
Definition
methylamine utilization protein MauG
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
gxy  Gluconacetobacter medellinensis NBRC 3288
Brite
Enzymes [BR:gxy01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     GLX_03340 (mauG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
392273..393484
Genome map
AA seq 403 aa AA seqDB search
MVIAMMLPRALPGHAHAIDGVVLSRPQARARAMALSALGRDLFHDRHLSASGQMACSSCH
ADGQAYAQANALSVQPGGHRAVPSLKYLQDVPQFTEHFFDSDDEADESIDNGPTGGLTWD
GRVDTAQAQARVPLLAPYEMANASPADVVSHALAAGYGQRIDALLFSAPNMETRFTLIAE
ALATYQQEERLFYPYTSKYDAVLAGRAKLTARESLGLRLFEQPDKGNCASCHVSAPGDDG
TPPQFTDYGLIALGVPRNMQITLNHDPNYFDMGLCGPDRTDLTNHPEYCGLFRTPSLRNV
ATRRVFFHNGMMHSLRQAVAFYVLRDIRPQMWYPKAPDGTVRKYDDLPARYHANINMDPP
FGPQPGNRPVLSDDEIDAIVAFLKTLTDGYATPGTYRSHGSAP
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atggtcattgcaatgatgctgcctcgtgcactgccagggcatgcacatgcaatagatggg
gttgtcctgtcccgcccgcaagcgcgtgcgcgtgcgatggcgctgagcgcactggggcgg
gacctgtttcacgaccggcacctttcggcatcaggacagatggcctgttcatcatgccat
gcggatggacaggcctatgcccaggccaacgctctgtccgtgcagccgggtgggcaccgg
gccgtgccatcactgaaatatctgcaggatgttccccagttcaccgagcatttttttgat
tccgatgatgaggccgatgaaagtatcgataatggccctaccggcggcctgacatgggac
gggcgggtcgatacggcgcaggctcaggcgcgggttcccctgctggccccgtatgagatg
gccaatgccagtccggccgacgttgtcagccatgcgctggcggctgggtatggccagcgc
attgatgccctgctgttttctgcccccaatatggagacacgctttaccctgattgccgaa
gcccttgcgacctaccaacaggaagagcggcttttttatccctataccagcaaatacgat
gcggtgctggcaggccgggctaaactgaccgcgcgtgaatcactgggcctgcgcctgttt
gaacagccggacaaaggcaactgcgcgtcttgccatgttagcgcaccgggggatgatggc
acgcccccgcaatttacggattatggcctgatcgctcttggcgtgccccgcaatatgcag
attacgctcaaccatgacccgaattactttgacatgggcctgtgcggccccgatcgcacg
gacctgaccaaccacccggaatattgcgggttgttccgcaccccatctctacgcaatgtg
gcgacgcggcgtgtattttttcataacgggatgatgcattccctgcgtcaggcggtcgcg
ttctatgtgctgcgtgatatccggccacagatgtggtacccaaaagcaccggacggaacg
gttcgcaagtatgatgacctgccggcgcgctaccatgccaacatcaatatggacccgcca
ttcggtcctcagccgggtaaccggccagtcctgtccgatgatgagatcgatgctatcgtc
gctttcctgaaaaccctgacggatggttatgccacgcctggaacctataggtcgcatggc
agcgctccatag

DBGET integrated database retrieval system