KEGG   Gluconacetobacter medellinensis NBRC 3288: GLX_05630Help
Entry
GLX_05630         CDS       T01631                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
gxy  Gluconacetobacter medellinensis NBRC 3288
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:gxy00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    GLX_05630
   00052 Galactose metabolism
    GLX_05630
   00500 Starch and sucrose metabolism
    GLX_05630
   00520 Amino sugar and nucleotide sugar metabolism
    GLX_05630
Enzymes [BR:gxy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     GLX_05630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
657379..658311
Genome map
AA seq 310 aa AA seqDB search
MKIDQMERFPVSVMHLEVNILVIKPLKKAVLPVAGLGTRFLPATKCVPKEMLTVVDRPLI
QYAIDEAREAGIEEFCLVSSRGKDSLIDYFDISYELEDTLKARKKASALKALEATRVTPG
SMLSVRQQEPLGLGHAIWCAREFIGNDPFAILLPDDVVQSKKSCIGQLVEVYNKTGGNVL
AVTEVPREQTGSYGILDVGHDDGKTVEVKGLVEKPDPKDAPSTLSVIGRYVLTADVLKHL
AKLEKGAGGEVQLTDAMAKTIGHVPFHGFRYEGKRFDCGSKVGFLEAQIAFALEREELAG
DVREFLKKYK
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatagaccagatggagcgatttcctgtttctgtcatgcatcttgaggtaaatatt
ttagtgatcaagccccttaaaaaagccgtattgccggttgccggtcttggaacgcgtttt
ctgcccgccaccaagtgcgtgcccaaggaaatgctgaccgtcgttgaccgcccgctcatc
cagtatgcgattgacgaggcacgtgaagccggaatcgaggaattctgccttgtttccagc
cggggcaaggactccctgatcgattatttcgatatttcctacgaactggaagacacgctg
aaggcccgcaagaaggcatcggccctgaaggcgctggaagcaacccgtgtcacccccggt
tccatgctgtccgtgcgccagcaggaaccgctgggcctgggccacgccatctggtgtgca
cgtgagttcatcggcaacgacccgttcgctatcctgctgcccgatgacgtggtgcagagc
aagaagtcgtgcatcggccagttggtcgaggtctataacaagaccggtggcaatgttctg
gccgtgaccgaagtgccgcgtgagcagaccggcagctacggcattcttgatgtcggccat
gacgatggcaagaccgtcgaggtcaagggcctggttgagaagcccgacccgaaggacgcg
ccctccaccctgtccgtgatcggtcgttacgtgctgacggcggatgtgctcaagcacctt
gccaagctcgagaagggtgccggcggtgaagtccagttgacggacgccatggccaagacc
atcgggcatgtgccgttccatggtttccgctacgaaggcaagcgcttcgactgcggcagc
aaggtcggcttccttgaagcccagattgccttcgcgctggagcgcgaggaactggcgggc
gacgttcgggaattcctgaaaaagtataaatga

DBGET integrated database retrieval system