KEGG   Gluconacetobacter medellinensis NBRC 3288: GLX_06090Help
Entry
GLX_06090         CDS       T01631                                 

Definition
delta-aminolevulinic acid dehydratase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
gxy  Gluconacetobacter medellinensis NBRC 3288
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gxy00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    GLX_06090
Enzymes [BR:gxy01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     GLX_06090
Exosome [BR:gxy04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   GLX_06090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
708309..709316
Genome map
AA seq 335 aa AA seqDB search
MELDWMSIGQFPHVRLRRNRRDRFTRRLVCENTLSTDNLIWPIFVTEGTGSVTDVASMPG
VQRVSLDRLAAHVEPAARLDIPAVALFPITPPGLRDEAGTEATNPDNLMCRAARLLKKEF
PEIGLIGDVALDPYTSHGHDGLIEGDYVVNDPSVAILSTQAVNQAAAGIDIIAPSDMMDG
RIGAIRTALDAGGLVNTRIMSYAAKYASAFYGPFRDALGSGGLLKGDKKTYQMDPANSDE
ALREVGQDLLEGADMVMVKPGMPYLDVIQRVRQEFSVPTFAYQVSGEYAMLMAAIQNGWL
DRDRVILESLMSFRRAGANGVLTYFALDAARLLQA
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atggagttggattggatgagtatcggtcaatttccccacgtaaggctacggcgcaaccgc
cgtgaccgctttacgcgccgcctcgtatgcgaaaacacactttcgaccgataacctgatc
tggccgatttttgtaacagagggaaccggctcggtcaccgatgtggcctccatgcccggc
gtgcagcgtgtcagccttgaccggctagcagcccatgtggaaccggcagcacggcttgat
atcccggccgtggccctgtttcccatcacgccccccggactacgtgatgaagccggaacc
gaagccaccaaccccgacaacctgatgtgccgcgcggcaaggctgctcaagaaggaattc
ccagaaattggcctgattggcgacgtggcgctggatccctataccagccacggccatgac
ggactgatcgagggtgattacgtggtcaatgacccgtccgttgccatcctgtccacacag
gcagtgaaccaggctgctgccgggatcgacatcatcgccccatcggacatgatggacgga
cgcattggcgccatccgcacagcccttgatgcgggcggtctggtcaatacccgcatcatg
tcctacgccgccaaatacgccagcgccttctacggtcccttccgcgatgcgctaggttca
ggcggcctgctgaagggggacaagaaaacctaccagatggaccccgccaatagcgacgag
gcactgcgtgaagttggccaggacctgctggaaggggccgacatggtcatggtcaagcct
ggcatgccgtatctggatgtgatccagcgcgtgcgacaggaattctcggtaccaaccttc
gcctaccaggtctcgggggaatacgcgatgctcatggccgcgatccagaatggctggctg
gaccgtgaccgcgtgatccttgaaagcctcatgtccttccgtcgtgcgggtgcgaatggg
gtactgacctatttcgcgcttgatgccgcccgcctgctgcaggcctaa

DBGET integrated database retrieval system