KEGG   Gluconacetobacter xylinus: GLX_06390Help
Entry
GLX_06390         CDS       T01631                                 

Definition
nicotinamidase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
gxy  Gluconacetobacter xylinus
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:gxy00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(740249..740866)
Genome map
AA seq 205 aa AA seqDB search
MADARTGRMNPVTCTDALLVIDMQVDFLPGGALAVAGADGLVPLINRLSHLPFGVVVASQ
DWHPADHVSFETCGGPWPVHCVAGTRGAALAPGLDQAAMGVLLRKGLDPDTDSYSAFADN
AHQHRTGLEGLLRERGISRVFVAGVALDYCVAHTARDARQAGFGTVVLHDACRAVAQDTQ
AVLAALDAQGINHAASVELLVQHTT
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atggctgatgcacggacagggcgcatgaatcctgtcacctgcaccgatgccctgctggtc
attgacatgcaggttgatttcctgcccggcggtgcactggccgtggcgggggcggatgga
ctggtcccgcttattaaccggttgagccatctgccctttggtgtggtggtggccagtcag
gactggcacccggctgatcatgtctcctttgaaacgtgtggtggcccgtggccggtccac
tgcgtggctggcacccgaggcgcggcacttgcgcccggccttgatcaggccgcgatgggc
gtgctgctgcgcaagggtctggaccccgatactgacagctattccgcctttgccgacaat
gcccaccaacaccgtaccgggctggaaggattgctgcgggagcgggggattagccgcgtt
tttgtggcaggtgtggcgctggattactgcgtagcccataccgcgcgggatgcgcggcag
gcagggttcgggaccgtggtgctacacgatgcctgccgtgccgtggcgcaggatacccaa
gccgttctggcggccctggatgcgcagggtattaaccatgccgccagcgtggaactgctg
gtgcagcacaccacctga

DBGET integrated database retrieval system