KEGG   Gluconacetobacter medellinensis NBRC 3288: GLX_06390Help
Entry
GLX_06390         CDS       T01631                                 

Definition
nicotinamidase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
gxy  Gluconacetobacter medellinensis NBRC 3288
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gxy00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    GLX_06390
Enzymes [BR:gxy01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     GLX_06390
    3.5.1.-  
     GLX_06390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(740249..740866)
Genome map
AA seq 205 aa AA seqDB search
MADARTGRMNPVTCTDALLVIDMQVDFLPGGALAVAGADGLVPLINRLSHLPFGVVVASQ
DWHPADHVSFETCGGPWPVHCVAGTRGAALAPGLDQAAMGVLLRKGLDPDTDSYSAFADN
AHQHRTGLEGLLRERGISRVFVAGVALDYCVAHTARDARQAGFGTVVLHDACRAVAQDTQ
AVLAALDAQGINHAASVELLVQHTT
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atggctgatgcacggacagggcgcatgaatcctgtcacctgcaccgatgccctgctggtc
attgacatgcaggttgatttcctgcccggcggtgcactggccgtggcgggggcggatgga
ctggtcccgcttattaaccggttgagccatctgccctttggtgtggtggtggccagtcag
gactggcacccggctgatcatgtctcctttgaaacgtgtggtggcccgtggccggtccac
tgcgtggctggcacccgaggcgcggcacttgcgcccggccttgatcaggccgcgatgggc
gtgctgctgcgcaagggtctggaccccgatactgacagctattccgcctttgccgacaat
gcccaccaacaccgtaccgggctggaaggattgctgcgggagcgggggattagccgcgtt
tttgtggcaggtgtggcgctggattactgcgtagcccataccgcgcgggatgcgcggcag
gcagggttcgggaccgtggtgctacacgatgcctgccgtgccgtggcgcaggatacccaa
gccgttctggcggccctggatgcgcagggtattaaccatgccgccagcgtggaactgctg
gtgcagcacaccacctga

DBGET integrated database retrieval system