KEGG   Gluconacetobacter medellinensis NBRC 3288: GLX_07290Help
Entry
GLX_07290         CDS       T01631                                 

Definition
zinc-dependent alcohol dehydrogenase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
gxy  Gluconacetobacter medellinensis NBRC 3288
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:gxy00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    GLX_07290
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GLX_07290
  Lipid metabolism
   00071 Fatty acid degradation
    GLX_07290
  Amino acid metabolism
   00350 Tyrosine metabolism
    GLX_07290
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    GLX_07290
   00626 Naphthalene degradation
    GLX_07290
Enzymes [BR:gxy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     GLX_07290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(838436..839470)
Genome map
AA seq 344 aa AA seqDB search
MAGKMKAAVVREFGKPLTIEELDIPTIRPDQILVKVDACGVCHTDLHAARGDWPTKPNPP
FIPGHEGIGHVVEVGSAVNWIKTGDVVGVPWLYSACGHCEHCLGGWETLCEKQEDTGYSV
NGCFAEYVVADPNYVAHLPKDIDPIKTAPVLCAGLTVYKGLKMTDTRAGEWVAISGAGGL
GQMAIQYAVAMGLNVAAVDISDEKLEEARKLGARVTVNALKHDPVAYIREQTGGTHGVLV
TAVSDKAFSQAVGYARRGGTVVLNGLPPGDFPLSIFDMVMNGTTVRGSIVGTRLDMIEAM
SFFTDGKVTTVVSPDRLENINTIFDNLEHGRVEGRIVLDFRNGA
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atggctggaaagatgaaggcagcggtagtgcgggaattcggcaagccgctgacaatcgag
gaactggatatccctacgattcgccctgaccagatcctggtcaaggtggatgcctgtggc
gtgtgccataccgacctgcacgcggcacgcggcgactggccgaccaagcccaatcccccc
ttcattcccggccatgaaggcattggccatgtggtggaggtcggctccgccgtgaactgg
atcaagacgggtgatgtggtgggcgtgccgtggctgtattccgcctgcgggcattgcgaa
cactgcctgggcgggtgggagacgctgtgtgagaagcaggaggataccggctattccgtc
aatggctgctttgcagaatacgtggtggccgatcccaattacgtggcccatctgcccaag
gatatcgaccccatcaaaacggccccggtgctgtgtgcggggctgaccgtgtacaagggc
ctgaagatgaccgatacgcgcgcgggggaatgggtggccatttcgggcgcgggcggcctt
gggcagatggccatccagtacgccgtggccatggggctgaatgtcgcggccgtggatatc
agtgacgagaagctggaagaagcccgcaagctgggtgcgcgggttacggtcaatgcgctg
aaacacgaccccgtcgcctatatccgtgaacagaccggcggcacgcatggcgtgctggtg
acagccgtgtcggacaaggcattcagccaggcggtgggctatgcgcggcgtggcggcacg
gtggtactcaacggtttgccgccgggggatttcccgctttccatctttgacatggtgatg
aacggtaccaccgtgcgtggatcgattgtcggcacgcggctggatatgatcgaggcgatg
tccttctttaccgatggcaaggtcacgacggttgtcagcccggacaggctggaaaacatc
aacaccattttcgataaccttgaacatggccgggtggaaggccgcatcgtgctggacttc
cgcaacggggcataa

DBGET integrated database retrieval system