KEGG   Komagataeibacter medellinensis: GLX_07290Help
Entry
GLX_07290         CDS       T01631                                 

Definition
(GenBank) alcohol dehydrogenase zinc-dependent
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
gxy  Komagataeibacter medellinensis
Pathway
gxy00010  Glycolysis / Gluconeogenesis
gxy00071  Fatty acid degradation
gxy00350  Tyrosine metabolism
gxy00625  Chloroalkane and chloroalkene degradation
gxy00626  Naphthalene degradation
gxy01100  Metabolic pathways
gxy01110  Biosynthesis of secondary metabolites
gxy01120  Microbial metabolism in diverse environments
gxy01130  Biosynthesis of antibiotics
gxy01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:gxy00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GLX_07290
  Lipid metabolism
   00071 Fatty acid degradation
    GLX_07290
  Amino acid metabolism
   00350 Tyrosine metabolism
    GLX_07290
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    GLX_07290
   00626 Naphthalene degradation
    GLX_07290
Enzymes [BR:gxy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     GLX_07290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N AlaDh_PNT_C 2-Hacid_dh_C ADH_zinc_N_2 3HCDH_N TrkA_N adh_short ELFV_dehydrog Methyltransf_25
Motif
Other DBs
NCBI-ProteinID: BAK83141
UniProt: G2I4U4
Position
complement(838436..839470)
Genome map
AA seq 344 aa AA seqDB search
MAGKMKAAVVREFGKPLTIEELDIPTIRPDQILVKVDACGVCHTDLHAARGDWPTKPNPP
FIPGHEGIGHVVEVGSAVNWIKTGDVVGVPWLYSACGHCEHCLGGWETLCEKQEDTGYSV
NGCFAEYVVADPNYVAHLPKDIDPIKTAPVLCAGLTVYKGLKMTDTRAGEWVAISGAGGL
GQMAIQYAVAMGLNVAAVDISDEKLEEARKLGARVTVNALKHDPVAYIREQTGGTHGVLV
TAVSDKAFSQAVGYARRGGTVVLNGLPPGDFPLSIFDMVMNGTTVRGSIVGTRLDMIEAM
SFFTDGKVTTVVSPDRLENINTIFDNLEHGRVEGRIVLDFRNGA
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atggctggaaagatgaaggcagcggtagtgcgggaattcggcaagccgctgacaatcgag
gaactggatatccctacgattcgccctgaccagatcctggtcaaggtggatgcctgtggc
gtgtgccataccgacctgcacgcggcacgcggcgactggccgaccaagcccaatcccccc
ttcattcccggccatgaaggcattggccatgtggtggaggtcggctccgccgtgaactgg
atcaagacgggtgatgtggtgggcgtgccgtggctgtattccgcctgcgggcattgcgaa
cactgcctgggcgggtgggagacgctgtgtgagaagcaggaggataccggctattccgtc
aatggctgctttgcagaatacgtggtggccgatcccaattacgtggcccatctgcccaag
gatatcgaccccatcaaaacggccccggtgctgtgtgcggggctgaccgtgtacaagggc
ctgaagatgaccgatacgcgcgcgggggaatgggtggccatttcgggcgcgggcggcctt
gggcagatggccatccagtacgccgtggccatggggctgaatgtcgcggccgtggatatc
agtgacgagaagctggaagaagcccgcaagctgggtgcgcgggttacggtcaatgcgctg
aaacacgaccccgtcgcctatatccgtgaacagaccggcggcacgcatggcgtgctggtg
acagccgtgtcggacaaggcattcagccaggcggtgggctatgcgcggcgtggcggcacg
gtggtactcaacggtttgccgccgggggatttcccgctttccatctttgacatggtgatg
aacggtaccaccgtgcgtggatcgattgtcggcacgcggctggatatgatcgaggcgatg
tccttctttaccgatggcaaggtcacgacggttgtcagcccggacaggctggaaaacatc
aacaccattttcgataaccttgaacatggccgggtggaaggccgcatcgtgctggacttc
cgcaacggggcataa

DBGET integrated database retrieval system