KEGG   Gluconacetobacter xylinus: GLX_07540Help
Entry
GLX_07540         CDS       T01631                                 

Definition
dihydrolipoamide acetyltransferase component (E2) of pyruvate dehydrogenase complex
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
gxy  Gluconacetobacter xylinus
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:gxy01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:gxy00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:gxy00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:gxy00620]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(860939..862207)
Genome map
AA seq 422 aa AA seqDB search
MPINILMPALSPTMKEGTLARWLKAEGDAIAAGDVIAEIETDKATMEVEAVDEGVLGRIL
IGEGTDGIAVNTPIAILVAEGESVPDAPAAPATAPAMAAPAPVPAQAVPTPQAPAASAAP
MAKGARVFASPLARRIAAQTGIDLATLRGSGPNGRIVRRDVEQARQTPAATPAATVAQAA
PAAAPAAPAGAAYDSVPHSGMRKVIARRLTEAKSTIPHFYVEMDVELDALLALRSQLNAA
APDEGPGAYKISVNDMLVKAAAVTLRRVPQVNVSYTDDAVLAYHDVDISVAVSIPDGLIT
PIVRAADTKGLRQISLETRDLVARARTGKLKPEEFQGGTFSISNMGMYGVKAFSAILNPP
QAAILAIAAGERRAVVKGSEIVIATVMTVTLSVDHRVVDGALAAQWLSAFRTVVENPMSL
VV
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgccgatcaacatcctgatgccagcgctttcccccaccatgaaggaaggcacgctggca
cgctggctcaaggcggaaggtgacgccattgcagcgggcgacgtgattgcggaaatcgag
accgacaaggccacgatggaagtcgaggccgtggatgaaggcgtgctgggccgtatcctg
attggcgagggcacggacgggattgccgtcaacacccccatcgccatactggtagccgaa
ggggaaagcgtgcccgacgcgcctgccgcccccgcaaccgccccggccatggcggccccg
gcgcccgtacctgcgcaggccgtcccgaccccgcaggcccctgccgcatcagccgcacct
atggcaaagggcgcacgcgtgtttgcttcccctcttgcgcgccgcattgcagcccagacg
ggcatcgaccttgccacgctcaggggcagcggccccaacgggcgcatcgtgcgccgtgat
gtggagcaggcgcggcagaccccggccgctacacccgctgccaccgtggcgcaggcggcc
cctgccgccgctcctgctgctcctgccggtgcggcatatgacagtgtgccgcattcgggc
atgcgcaaggtgattgcgcgccgcctgacggaagccaagtccaccatcccgcatttttat
gtggaaatggatgtggaactggacgcgctgctggccctgcgcagccagcttaatgcagcc
gcccctgatgaagggccgggtgcgtacaagatctcggtcaatgacatgctggtcaaggcg
gcggcggtgaccctgcgccgcgtgccgcaggtcaatgtgtcctataccgatgatgcggtg
ctggcgtatcatgatgtggatatttctgttgccgtctccatccccgacgggctgatcacc
cccatcgtgcgcgcggccgacaccaagggcctgcgccagatcagccttgagacacgcgac
cttgtggcgcgcgcgcggacaggcaagctgaagccggaggaattccagggcggcaccttc
tccatctccaatatggggatgtatggggtcaaggcgttctccgccatcctcaacccgcca
caggcggccatcctggccattgcggcgggtgagcgcagggcggtggtcaagggcagcgag
attgtcattgccacggtcatgacggtcacgctttcggtcgatcaccgggtggtggatggg
gcgctggccgcacagtggctttcggccttccgtacggttgttgaaaacccgatgagcctt
gtggtctga

DBGET integrated database retrieval system