KEGG   Komagataeibacter medellinensis: GLX_07630Help
Entry
GLX_07630         CDS       T01631                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
gxy  Komagataeibacter medellinensis
Pathway
gxy00010  Glycolysis / Gluconeogenesis
gxy00051  Fructose and mannose metabolism
gxy00562  Inositol phosphate metabolism
gxy01100  Metabolic pathways
gxy01110  Biosynthesis of secondary metabolites
gxy01120  Microbial metabolism in diverse environments
gxy01130  Biosynthesis of antibiotics
gxy01200  Carbon metabolism
gxy01230  Biosynthesis of amino acids
Module
gxy_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:gxy00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GLX_07630
   00051 Fructose and mannose metabolism
    GLX_07630
   00562 Inositol phosphate metabolism
    GLX_07630
Enzymes [BR:gxy01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     GLX_07630
Exosome [BR:gxy04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   GLX_07630
  Exosomal proteins of bladder cancer cells
   GLX_07630
  Exosomal proteins of melanoma cells
   GLX_07630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: BAK83175
UniProt: G2I4X8
Position
872005..872748
Genome map
AA seq 247 aa AA seqDB search
MKQIIVGNWKMNGLSADADALVTGLAAGLAALPTRADVVVCPPFTQLARLAPKLKAAGIA
LGAQDCHKDKSGAHTGDISAPMLADLGVQYVILGHSERRAEHGELDETVREKTVAAMAAG
LTPIVCVGENADQRDSGDSRDAVGWQIQGSLPQGFTGIVAYEPIWAIGSGTAASQQDIAD
MSAFIRAELVRQFGEAGKTIRILYGGSVNERNVTDILPVENVDGALVGNASLKADAFVPL
VRAARAS
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgaagcagattattgttggcaactggaagatgaacggcctgagcgccgatgcggacgcg
ctggtcacggggctggcggcggggctggccgccctgcccacgcgggccgatgtggtggtc
tgccccccctttacccagcttgcgcggctggcgcccaagctgaaggccgctggcatcgcg
ctgggtgcccaggactgccacaaggacaaatccggtgcccataccggtgacatctcggcc
cccatgctggcggaccttggggtgcagtacgtaatccttggccattccgagcgccgtgcc
gagcatggcgaactggacgagaccgtgcgcgaaaagaccgtggccgccatggccgccggc
ctgacccccatcgtgtgcgtgggcgagaacgccgatcagcgcgacagcggggattcgcgc
gatgcggtgggctggcagatccagggatcactgccacagggttttactggcattgtggcg
tatgagccgatctgggccatcggctcgggtacggccgcatcacagcaggatattgccgac
atgtccgccttcatccgcgccgaactggtgcgccagttcggggaagctggcaaaacgatc
cgaatcctttatggtggctcggtcaatgaacgcaatgtcaccgatatcctgcccgttgaa
aacgtggatggggcgctggtgggcaatgccagcctgaaggccgatgccttcgtgccgctt
gtccgcgccgcccgcgcctcgtga

DBGET integrated database retrieval system