KEGG   Gluconacetobacter medellinensis NBRC 3288: GLX_07630Help
Entry
GLX_07630         CDS       T01631                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
gxy  Gluconacetobacter medellinensis NBRC 3288
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:gxy00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    GLX_07630
   01230 Biosynthesis of amino acids
    GLX_07630
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GLX_07630
   00051 Fructose and mannose metabolism
    GLX_07630
   00562 Inositol phosphate metabolism
    GLX_07630
Enzymes [BR:gxy01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     GLX_07630
Exosome [BR:gxy04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   GLX_07630
  Exosomal proteins of bladder cancer cells
   GLX_07630
  Exosomal proteins of melanoma cells
   GLX_07630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
872005..872748
Genome map
AA seq 247 aa AA seqDB search
MKQIIVGNWKMNGLSADADALVTGLAAGLAALPTRADVVVCPPFTQLARLAPKLKAAGIA
LGAQDCHKDKSGAHTGDISAPMLADLGVQYVILGHSERRAEHGELDETVREKTVAAMAAG
LTPIVCVGENADQRDSGDSRDAVGWQIQGSLPQGFTGIVAYEPIWAIGSGTAASQQDIAD
MSAFIRAELVRQFGEAGKTIRILYGGSVNERNVTDILPVENVDGALVGNASLKADAFVPL
VRAARAS
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgaagcagattattgttggcaactggaagatgaacggcctgagcgccgatgcggacgcg
ctggtcacggggctggcggcggggctggccgccctgcccacgcgggccgatgtggtggtc
tgccccccctttacccagcttgcgcggctggcgcccaagctgaaggccgctggcatcgcg
ctgggtgcccaggactgccacaaggacaaatccggtgcccataccggtgacatctcggcc
cccatgctggcggaccttggggtgcagtacgtaatccttggccattccgagcgccgtgcc
gagcatggcgaactggacgagaccgtgcgcgaaaagaccgtggccgccatggccgccggc
ctgacccccatcgtgtgcgtgggcgagaacgccgatcagcgcgacagcggggattcgcgc
gatgcggtgggctggcagatccagggatcactgccacagggttttactggcattgtggcg
tatgagccgatctgggccatcggctcgggtacggccgcatcacagcaggatattgccgac
atgtccgccttcatccgcgccgaactggtgcgccagttcggggaagctggcaaaacgatc
cgaatcctttatggtggctcggtcaatgaacgcaatgtcaccgatatcctgcccgttgaa
aacgtggatggggcgctggtgggcaatgccagcctgaaggccgatgccttcgtgccgctt
gtccgcgccgcccgcgcctcgtga

DBGET integrated database retrieval system