KEGG   Komagataeibacter medellinensis: GLX_08090Help
Entry
GLX_08090         CDS       T01631                                 

Definition
(GenBank) glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
gxy  Komagataeibacter medellinensis
Pathway
gxy00330  Arginine and proline metabolism
gxy00332  Carbapenem biosynthesis
gxy01100  Metabolic pathways
gxy01130  Biosynthesis of antibiotics
gxy01230  Biosynthesis of amino acids
Module
gxy_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:gxy00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    GLX_08090
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    GLX_08090
Enzymes [BR:gxy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     GLX_08090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA CW_binding_2
Motif
Other DBs
NCBI-ProteinID: BAK83221
UniProt: G2I524
Position
929855..931024
Genome map
AA seq 389 aa AA seqDB search
MTDTALPHLRTARRIVVKIGSALIVDPDHATPRQAWLDSVAQDIADLRAQGTEVVVVSSG
AIALARHQLGLTRRVLRLEEKQAAASVGQIRLAQAWTDALSGHGLTAAQLLLTPDDTENR
NRYLNARASLNTLLGLGCVPVINENDAIATTEIRFGDNDRLAARVAEMINADQLVLLSDI
DGLYTADPRNDPDARHLPVVAELTDSIEAMGGAPPPGYSSGGMRTKLMAARIATQSGCAM
AITQGQPLHPLGRLRDGGRCTWFLPATDARSARKSWIAGSLTPAGHMVIDDGAVQALMLG
SSLLPAGVKEVAGDFDRGDLIAVLDRHGRRVACGLAGYGAEDAGRIAGCQSDEIEGLLGW
QGADELIHRDDLVLFARTEPTTDQTIPHK
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgacggatacagccctgccccacctgcgtacggcacggcggattgtcgtaaagattggc
agcgccctgatcgtggaccccgaccacgcaaccccccggcaggcctggctggacagcgtg
gcgcaggacatcgccgacctgcgcgcgcagggcacggaagtggttgtggtctcgtctggc
gccattgcccttgcccgccaccaactgggactgacgcgccgcgtgctgcggctggaggaa
aagcaggccgctgcctccgtcggtcagatccggctggcgcaggcttggaccgatgcgcta
tcgggtcatgggctgacagccgcccaactgctgctgacccccgatgataccgagaatcgc
aaccgctatctcaacgcccgcgcctcgctcaacacgctgctggggctgggctgcgtaccc
gtcatcaatgaaaacgacgccattgccaccaccgaaatccgctttggcgacaatgaccgc
ctggcggcccgggtggcggaaatgatcaatgcggaccagcttgtgctgctgtccgatatt
gacgggctgtacaccgccgacccgcgcaacgaccccgacgcacggcacctgccggtcgtg
gctgaactgaccgacagtatcgaagccatgggcggtgcgccgccaccaggctattcatcg
ggcggcatgcggaccaagctcatggctgcgcggatcgcaacgcagtcgggctgcgccatg
gccattacgcagggccagccgctgcacccgctgggccgcctgcgtgatggcgggcgctgc
acatggttcctgcccgcgaccgacgcccgatccgcccgcaagagctggatcgcgggcagc
ctgacaccagcgggccatatggtaattgacgatggcgcggtgcaggcgctgatgctgggg
tcatcgctgctaccagcgggcgtgaaggaagtggcgggcgattttgaccgtggtgacctg
attgcggtgctggaccgccatggccgccgggttgcctgcgggctggcaggctatggggcg
gaagatgcgggccggatcgcgggctgccagtcggatgaaatcgaaggcctgctgggctgg
cagggcgcggatgaactgatccaccgcgatgacctggtgctgtttgcccgtacggaaccg
acaaccgaccaaaccattccacataaataa

DBGET integrated database retrieval system