KEGG   Gluconacetobacter xylinus: GLX_08180Help
Entry
GLX_08180         CDS       T01631                                 

Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
gxy  Gluconacetobacter xylinus
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:gxy00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:gxy00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
940448..941920
Genome map
AA seq 490 aa AA seqDB search
MLLSELLQREGLDGARVTHASKTDIHAISPDSRRIGPGMIFAALRGTHADGRAHIAQAMA
QGAAAVLVEHDPAFTPPPGVTCIVAADARAALAHIARVLTPRLPTHIAAITGTNGKTSTA
EFLRQIWTLLALPAATIGTLGALAPCPLPDCGPVLTTPDSVGLMCLLGAMAQAGVEHVAV
EASSHGLEQRRLDGLRPYAAGFSNLTRDHLDYHGTTEHYRAAKLRLFDTILPEGGIAAFN
ADMDTATCTALRMIAARRGLVVRTTGVRGETLRLMDVRPMPAGQIVQVMTPTGRREMEVP
LVGRFQVDNMLLACAMAGADDNAPERAVSLLPRLHGVRGRLERVGVLDNGAAAYVDYAHT
PDAIERLLCSLRPHTPGRLVIVMGAGGDRDRGKRPVMGEVATRLADRVIVTDDNPRTEVA
AAIRAAIMAAAPGATEIGDRRQAIATGLGLLGAGDVLVVAGKGHEQGQTIGHDVLPFDDA
TVIRDLMGTE
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgctgctgagtgaactcctgcaacgcgaggggctggatggcgcgcgggttacccatgca
tcgaaaaccgacatccacgccatctcccccgatagccgccggatcggcccgggcatgatc
tttgccgccctgcgcggcacgcatgcggacgggcgcgcccatattgcccaggccatggca
cagggtgctgccgccgtgctggtggagcacgaccctgccttcaccccgccgccgggtgtg
acctgcatcgtggcggcagatgcgcgtgcggcgctggcacacatcgcccgcgtgctgaca
ccccgactgcccacgcatatcgccgctataaccggtaccaacggcaagaccagcacggcg
gaattcctgcgccagatatggaccctgttggccctgcctgccgcaaccatcggcacgctg
ggcgcactggccccctgcccgctacccgattgcggccccgtactgaccacaccggacagc
gtggggctgatgtgccttctgggcgccatggcacaggcgggggtggaacatgtggcggtc
gaggcctcatcacacgggctggagcagcgcaggctggacgggctgcgcccctatgcagca
gggttcagcaacctgacacgcgaccatctggactatcacggcacgaccgaacactaccgc
gcagccaagttgcgcctgttcgacacgatcctgcccgaaggaggcattgccgccttcaat
gcggatatggatacggccacctgcaccgccctgcgcatgatcgcggcccggcgcgggctg
gtcgtgcgcacgacgggggtgcggggcgagaccctgcgtcttatggacgtgcggcccatg
ccggcggggcagatcgtgcaggtcatgaccccgacgggccgacgggaaatggaagtgccg
ctggtcggccgtttccaggtggacaacatgctgctggcctgtgccatggcaggcgcggat
gacaatgcacccgagcgtgccgtcagcctgctgccccgcctgcacggcgtgcgcgggcgc
ctggagcgcgtgggtgtgctggataacggggcggccgcctatgttgattacgcccatacg
ccagacgccatcgagcgcctgctgtgctccctgcggccccatacgccgggccgacttgtt
attgtaatgggagctggcggcgaccgtgaccggggcaagcggccggtgatgggcgaagtc
gcaacccgtctggccgaccgggtgatcgtaaccgatgacaatccgcgcacggaagtcgcc
gccgccattcgcgccgccatcatggcagccgcaccgggtgcgaccgagatcggtgaccgg
cggcaggccattgccacgggccttgggctgctgggagcgggggacgtgctggtggtggca
ggcaagggccatgagcagggccagacaatcggccacgacgtgctgccatttgacgatgcc
acggtaatccgtgacctgatggggactgaatga

DBGET integrated database retrieval system