KEGG   Gluconacetobacter medellinensis NBRC 3288: GLX_09580Help
Entry
GLX_09580         CDS       T01631                                 

Definition
chemotaxis response regulator
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
gxy  Gluconacetobacter medellinensis NBRC 3288
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:gxy00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    GLX_09580
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    GLX_09580
Enzymes [BR:gxy01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     GLX_09580
Two-component system [BR:gxy02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   GLX_09580
Bacterial motility proteins [BR:gxy02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    GLX_09580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1106405..1107499)
Genome map
AA seq 364 aa AA seqDB search
MSRVSTAEPPRRVLIVEDSAVLRHLLMRVVAGDPRLELAEAVETAEEALRLVPRLRPDVI
SMDICLPGMDGLEATRQIMAHFPTPIVIVSDTLGGQATHVSMNALRSGALAVLEKPQGLS
GAAGVAVAQGIATQLYIMSQVPVIRRRLMKADPFRHKGMWTRPLAIHPRILALAASTGGP
TAFARVLGDLPADFGLPVVLVQHMGAAFMEGFAQWLDQQVALPVMLARHGMALEEGRVLV
APGNQHMSVGTRGEVVLHDGPPVQGQRPSADVLFSSVAQVFGADALGVLLTGMGEDGVDG
LGRIRARGGYTIAEDRSTAVIHGMPGAAERAGAACISLPVHEIAPHILRIMAGSPLPSEG
PSNP
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
gtgagtcgtgtctccaccgccgagccgccgcgccgcgtgctgatcgtggaggattcggcc
gtgctgcgccacctgctcatgcgcgtggtggcgggcgatccgcgccttgaactggcggag
gcggtggaaacggcggaggaagcactgcgccttgttccgcgcctgcggcctgatgtgatc
tcgatggatatctgcctgcccggcatggacgggctggaggccacgcgccagatcatggcg
cattttcccacccccatcgtgatcgtaagtgatacgctgggcgggcaggcgacccatgtc
tccatgaacgcgctgcgctcgggcgcgctggcagttctggaaaagccgcagggcctgtcg
ggcgctgccggggttgccgtggcgcagggtattgcaacccaactctatatcatgagtcag
gtgcccgtgatccgccgccgcctgatgaaggccgacccctttcgccacaagggcatgtgg
acacgcccgctggccattcacccgcgtattcttgcccttgcggcctccaccggcggccct
actgcctttgcccgtgtgctgggtgacctgccagcggatttcgggctgccggtggtgctg
gtccagcacatgggggctgccttcatggaagggtttgcccagtggctggaccagcaggtg
gcgctgccggtcatgctggcgcgtcacggcatggcgctggaggagggccgcgtgctggtg
gcgccgggtaaccagcacatgagtgttggcacgcggggcgaggtcgtgctgcatgacggg
ccgcccgtgcaggggcagcggccttcggcggatgtgctgttttcctccgttgcacaggta
ttcggtgccgacgcgctgggcgtgctgctgaccggcatgggcgaggacggcgtggatggc
cttggccgtatccgtgcacgcggcggctacacgatcgcggaggatcgcagcactgccgtc
atccacggtatgcccggtgccgccgaacgcgcgggggctgcctgcatcagcctgccagtg
catgaaatcgccccgcatattttgcggatcatggcgggcagcccgctcccttctgaagga
ccatccaacccatga

DBGET integrated database retrieval system