KEGG   Komagataeibacter medellinensis: GLX_09830Help
Entry
GLX_09830         CDS       T01631                                 

Definition
(GenBank) 3'(2'),5'-bisphosphate nucleotidase
  KO
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
gxy  Komagataeibacter medellinensis
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:gxy00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    GLX_09830
Enzymes [BR:gxy01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     GLX_09830
Transfer RNA biogenesis [BR:gxy03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    GLX_09830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1131293..1132078
Genome map
AA seq 261 aa AA seqDB search
MNTPSIPAYEDGFLVDLALRLAREAAELIRAIRARGFATQVKTDSSPVTEADHAAEAHIL
KGLRAQAPAIPVVAEEEMAAGIRINAGSEFWLVDPLDGTREFAAGRDDFTVNIGLVRNGR
PVLGAVALPAYHQLYGAGAGRGAFRIDASGTQPIHVRTTPAEGLTVLASRHYADDPRLKQ
FLGGHRVAHLGNIGSAAKFIRVAEGLADLYPRLGTTMEWDTAAPQAIVEAAGGTVTTTDG
QPLGYGKPTWRNPHFVCRGAA
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgaatacaccatccatcccggcatatgaggacggattccttgtggatctggccctacgc
cttgcccgtgaggccgccgaactgatccgcgccatccgcgcgcgcggctttgccacgcag
gtcaagaccgacagctctcccgtgaccgaggccgaccacgcagccgaggcccatatcctc
aagggcctgcgcgcgcaggccccggccatcccggtggtggcggaagaggaaatggccgcc
ggcatccgcatcaatgcagggagcgagttctggctggtggacccgctggacggcacgcgg
gaattcgcggccgggcgcgatgactttaccgtcaatatcggcctggtccgcaacggccgc
ccggtgctgggggccgtggcgctgcccgcctaccaccagctttatggcgcgggtgccggg
cgcggagccttccgaattgacgccagtggcacgcagccgatccatgtccgcaccaccccg
gcggaggggctgacggtgctcgcctcgcgccattatgccgatgacccacgcctgaagcaa
ttcctgggcggccatcgcgtcgcgcatctgggcaatatcggctcggcggccaagttcatc
cgcgtggcggaagggctggcggacctgtatccccgccttggcaccaccatggaatgggat
accgctgccccgcaggccatcgtggaagccgctggcggcacggttacgacaaccgatggc
cagccgctgggctatggcaagcccacatggcgcaatccgcacttcgtgtgtcgcggcgcg
gcatag

DBGET integrated database retrieval system