KEGG   Gluconacetobacter medellinensis NBRC 3288: GLX_11140Help
Entry
GLX_11140         CDS       T01631                                 

Definition
DNA recombinase
Orthology
K06187  
recombination protein RecR
Organism
gxy  Gluconacetobacter medellinensis NBRC 3288
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:gxy00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    GLX_11140
DNA repair and recombination proteins [BR:gxy03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      GLX_11140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1275231..1275827)
Genome map
AA seq 198 aa AA seqDB search
MSGRGEIDRLITLLGRLPGLGPRSARRAALALLRQPHARMLPLAQAMEQAARAVRTCSRC
GNLDTTDPCGICTDPTRDDGLVCVVENVGDLWALERAGVHRGVYQVLGGTLSALSGIGPD
DLNVQSLLDRIAAGGVREVILALGTTVEGATTMHWLHERLARFDVQVSRVGQGVPVGGAL
DVLDDGTLAAAIMARRPA
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgagcggccgcggcgagatcgaccgcctgataaccctgctgggtcgcctgccggggctg
gggccacgttcggcacggcgcgcggcccttgccctgctgcgccagccccatgcacgcatg
ctgcctctggcgcaggccatggaacaggcggcgcgggccgtgcgcacctgttcgcgctgc
ggcaatctggacaccacagacccgtgtggcatctgtacggaccccacgcgtgatgacgga
ctggtctgcgtggtggagaacgtgggcgacctgtgggcgctcgagcgtgcgggcgtgcat
cgtggtgtgtatcaggtgctcggtggtacgctctccgccctttcgggcatcgggccggat
gacctgaatgtccagtccctgctggaccgtatcgccgctggtggtgtgcgcgaggtgatc
cttgcactgggcaccacggtagagggcgctacaaccatgcactggctgcatgaacgtctt
gctcgttttgatgtgcaggtcagtcgtgtggggcagggcgtgcccgtagggggcgcgctg
gatgtgctcgatgacggcacacttgctgctgccatcatggcgcgtcggcccgcatga

DBGET integrated database retrieval system