KEGG   Gluconacetobacter xylinus: GLX_11140Help
Entry
GLX_11140         CDS       T01631                                 

Definition
DNA recombinase
Orthology
K06187  
recombination protein RecR
Organism
gxy  Gluconacetobacter xylinus
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:gxy03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1275231..1275827)
Genome map
AA seq 198 aa AA seqDB search
MSGRGEIDRLITLLGRLPGLGPRSARRAALALLRQPHARMLPLAQAMEQAARAVRTCSRC
GNLDTTDPCGICTDPTRDDGLVCVVENVGDLWALERAGVHRGVYQVLGGTLSALSGIGPD
DLNVQSLLDRIAAGGVREVILALGTTVEGATTMHWLHERLARFDVQVSRVGQGVPVGGAL
DVLDDGTLAAAIMARRPA
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgagcggccgcggcgagatcgaccgcctgataaccctgctgggtcgcctgccggggctg
gggccacgttcggcacggcgcgcggcccttgccctgctgcgccagccccatgcacgcatg
ctgcctctggcgcaggccatggaacaggcggcgcgggccgtgcgcacctgttcgcgctgc
ggcaatctggacaccacagacccgtgtggcatctgtacggaccccacgcgtgatgacgga
ctggtctgcgtggtggagaacgtgggcgacctgtgggcgctcgagcgtgcgggcgtgcat
cgtggtgtgtatcaggtgctcggtggtacgctctccgccctttcgggcatcgggccggat
gacctgaatgtccagtccctgctggaccgtatcgccgctggtggtgtgcgcgaggtgatc
cttgcactgggcaccacggtagagggcgctacaaccatgcactggctgcatgaacgtctt
gctcgttttgatgtgcaggtcagtcgtgtggggcagggcgtgcccgtagggggcgcgctg
gatgtgctcgatgacggcacacttgctgctgccatcatggcgcgtcggcccgcatga

DBGET integrated database retrieval system