KEGG   Gluconacetobacter medellinensis NBRC 3288: GLX_12460Help
Entry
GLX_12460         CDS       T01631                                 

Definition
aspartate carbamoyltransferase
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
gxy  Gluconacetobacter medellinensis NBRC 3288
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gxy00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    GLX_12460
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    GLX_12460
Enzymes [BR:gxy01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     GLX_12460
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1430258..1431223
Genome map
AA seq 321 aa AA seqDB search
MSERGSHGSNVFLTRPARHLLGVQGMHPSRITPFLDLAEHYALLNRSRKTPRDLLRGRTL
INLFFEDSTRTRTSFELAGKRLGADVVNMTVASSSVNKGETLLDTAATLNAMHTDLLVVR
HSQSGAPALLAQKVQASVVNAGDGTHEHPTQALLDALTIRRHFGMFEGLTVAICGDVSHS
RVARSNIHLLTAMGCQVRVVGPPTLVPGAIGALGVSIHHTMEDGLRGVDVVMMLRVQRER
MQGTQVPSAREYFRFYGLDNKRLALARPQALVMHPGPMNRGVEIDSRVADSDQSVIREQV
EMGVAVRMAVLDILSRGGEGA
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgagtgagcgcggcagccatggcagcaacgtcttcctgacccgtccggcgcgccacctg
ctgggtgtgcagggcatgcatcccagccggatcacgcccttccttgacctggcggagcat
tatgccctgctcaaccggtcgcgcaaaacaccgcgtgacctgctgcgcgggcgcacgctg
atcaacctgtttttcgaagacagcacccgcacccgcacctcgtttgaactggcgggcaaa
cggctgggtgccgatgtggtgaacatgacagtcgccagttcctcggtgaacaagggcgag
acactgctggacacggccgcaacgctgaacgccatgcataccgacctgctggtggtccgc
cattcgcagtccggcgcacccgccctgctggcgcagaaggtgcaggccagtgtggtcaat
gccggtgatggcacacatgaacacccgacacaggcactgctggacgcgctgaccatccgc
cgccacttcggcatgttcgagggactgaccgttgccatatgcggtgatgtcagccacagc
cgtgtcgcccgctccaacatccacctgctgaccgccatgggctgccaggtgcgcgtggtg
ggaccgccaacactggtgcccggcgccatcggagcgctgggggtgagtattcaccatacg
atggaagatggcctgcgcggggtggacgtggtgatgatgctgcgtgtgcagcgcgagcgc
atgcagggcacgcaggtgcccagcgcgcgtgagtatttccgtttctacgggctggataac
aagcgtcttgcgctggcaaggccgcaggcgcttgtcatgcatcccggcccgatgaaccgg
ggcgtggaaatcgacagtcgtgtcgccgattccgatcagagcgtgatccgcgaacaggtg
gaaatgggggttgccgtacgcatggcggttctggacatcctctcacgtggaggagagggc
gcatga

DBGET integrated database retrieval system