KEGG   Gluconacetobacter xylinus: GLX_12670Help
Entry
GLX_12670         CDS       T01631                                 

Definition
dioxygenase
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
gxy  Gluconacetobacter xylinus
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:gxy00270]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1457698..1458240)
Genome map
AA seq 180 aa AA seqDB search
MSRLRVYADNNPGTPIIQLGDPARIAMELAGIGVRFERWDAPVVPPRDAPESAVLDAYRP
YLDQLMGETGAGSADVLRVGPDTQGWAQARSKYLSEHTHSEDEVRFFVHGQGDFILHVNG
RVYDVRCTAGDLISVPAGISHWFDGGETPDFVTLRIFTNPDGWIAQYTGSDIATRFPAEA
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgagccgcctgcgtgtctatgccgataacaatcccggaacccccattatacagctgggt
gatcccgcgcgcattgccatggagcttgcgggcattggcgtgcgtttcgagcgctgggat
gcccccgtcgtgcccccgcgtgatgcaccggaaagcgccgtgctcgatgcctatcgcccc
tatcttgaccagttgatgggcgagacgggtgccggttcggccgatgtgctgcgcgtgggg
cctgatacccagggctgggcgcaggcgcgcagcaaatacctgtccgaacatactcatagc
gaggacgaggtgcgttttttcgtacacgggcagggcgatttcatcctgcatgtgaacggg
cgcgtgtacgatgtgcgctgcacggcgggcgacctgatttcggtgccggcgggcatatcg
cactggtttgacggtggcgagacgcccgatttcgtcacgctgcgcatcttcaccaacccc
gatggctggatcgcgcagtacaccggcagcgatattgcaacccgctttcctgccgaagcc
tga

DBGET integrated database retrieval system