KEGG   Gluconacetobacter medellinensis NBRC 3288: GLX_13440Help
Entry
GLX_13440         CDS       T01631                                 

Gene name
rusA
Definition
Holliday junction resolvase RusA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
gxy  Gluconacetobacter medellinensis NBRC 3288
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:gxy00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    GLX_13440 (rusA)
Enzymes [BR:gxy01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     GLX_13440 (rusA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1540682..1541302)
Genome map
AA seq 206 aa AA seqDB search
MIAQLRGLLAQVEADRCVIDVSGVGYLVQASSRTLAVLPQPPELALVLVETVVREDAILL
YGFAEPSERSWFRLLTTVQGVGAKVALAILSVLPPPELMVAIGSGDKAMLTRAGGVGARL
AQRIVTELRDKCEGMPTGVAAGAGVAGVTITMPTPHSIAADALLALSGLGFRRGEALSVV
ERVIERHEGKVDLDVVIRDALKELAR
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgatcgcacagttgcgcggcctgctggcgcaggtggaagccgaccgctgcgtgattgac
gtaagcggtgtgggctatcttgtgcaggcatccagccgcacgctggcggtactgccccag
ccgccggaactggctttggtactggtggaaaccgtggtgcgcgaggacgcgatcctgctg
tacggctttgccgagccatcggaacgctcatggttccgtctgctgaccacggtgcagggc
gtgggagccaaagtggcgctggccatcctgtcggttttgccgccgcctgaactcatggtg
gccatcgggtcgggtgacaaggccatgctgacccgcgcaggcggcgtgggtgcgcgactg
gcccagcgaatcgtgactgaactgcgtgacaagtgcgaaggtatgcccaccggcgtggca
gcgggggcaggcgtggcgggtgtgaccattaccatgcccacgccgcacagcattgcggcg
gatgcgctgcttgcgctgtctggccttggcttcaggcgcggggaggcgctgtcggtggtg
gaacgggtgattgagcggcatgaaggcaaggtagaccttgatgtcgtgatccgtgacgcg
ctgaaggaactggctcgatga

  All links  
No link information was found.   
DBGET integrated database retrieval system