KEGG   Komagataeibacter medellinensis: GLX_13610Help
Entry
GLX_13610         CDS       T01631                                 

Definition
(GenBank) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
gxy  Komagataeibacter medellinensis
Pathway
gxy00790  Folate biosynthesis
gxy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gxy00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    GLX_13610
Enzymes [BR:gxy01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     GLX_13610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI QueF
Motif
Other DBs
NCBI-ProteinID: BAK83773
UniProt: G2I6M6
Position
1559856..1560461
Genome map
AA seq 201 aa AA seqDB search
MTPIDTRPTRADAEEAVRTLLRWAGEDPGREGLLDTPARVVKSYGEFFCGYAEDPAEMLR
RTFSEVADYDEMVLLRDIRVESHCEHHMVPIIGVAHVAYLPRRRVVGISKLARVVDAYAR
RFQIQERLTAQIANTINDELQPYGVGVVIEAAHQCMTTRGVHRPGVSMVTSRMLGTFRTN
SDTRREFLSILNRPAMNGTGI
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgacccccattgacacccgtcccacccgagcggacgccgaagaagctgtacggaccctg
ctacgctgggcaggcgaggaccctggccgcgaaggcctgcttgatacgcccgcgcgagtc
gtgaaatcctacggcgagtttttctgcggctacgcggaagaccctgcggaaatgctacgc
cgcaccttttcggaagtagcggattatgacgagatggtcctgctgcgtgatatccgcgtg
gagagtcactgcgagcaccacatggtgcccattattggcgtagcgcatgtggcctacctg
ccgcgcaggcgggttgtgggcatttccaagctggcccgggtggtggacgcttatgcccgc
cgtttccagatacaggaacgcctgacggcccagatcgccaacaccatcaatgacgaactc
cagccctatggcgtaggcgtggtgatcgaggccgcccaccagtgcatgactacgcgcggc
gtgcaccgccccggcgtatccatggtgaccagtcgcatgctaggcacattccgcaccaat
tccgacacacggcgggaattcctgtcgattctgaaccgtccggccatgaacggcaccggg
atctga

DBGET integrated database retrieval system