KEGG   Gluconacetobacter xylinus: GLX_13700Help
Entry
GLX_13700         CDS       T01631                                 

Definition
alpha-acetolactate decarboxylase
Orthology
K01575  
acetolactate decarboxylase [EC:4.1.1.5]
Organism
gxy  Gluconacetobacter xylinus
Pathway
Butanoate metabolism
C5-Branched dibasic acid metabolism
Class
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:gxy00650]
Metabolism; Carbohydrate metabolism; C5-Branched dibasic acid metabolism [PATH:gxy00660]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1571200..1572114)
Genome map
AA seq 304 aa AA seqDB search
MEIGFNIYWTYEPACITISLQSQMTGLRRCHVPHCPPMQETEVVKLKCYSVGDVDTRSSA
ADSTGVRPRMNRLYQTSTMAALLDAVYDGETTLDELLMHGNFGLGTFNGLDGEMIVNDSV
IHQFRADGQAGRVPGDLRTPFACVTFFNPEKEYMIDTAQDKEGFEAIVDHLVNNPNLFAA
VRFTGMFERVETRTVFCQCQPYPPMLEVVARQPTMQLGASTGTMLGFRTPGYMQGVNVAG
YHLHFLTEDGRRGGHVTDYGVLRGRLEVGVISDVEIQLPRTEQFARANLSPENIHEAIRV
AEGG
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atggaaataggctttaatatatattggacgtacgaacctgcctgcatcaccattagtctg
caatcacaaatgaccgggttgaggcgatgccatgtgccgcattgtcccccgatgcaggag
actgaggtcgtgaagcttaaatgctactcggtaggggatgttgatacccggtccagcgct
gctgattcgactggcgtgcgtccgcgcatgaaccgcctgtaccagacatcgaccatggcc
gcgctgcttgatgcggtctatgatggcgagaccacgcttgatgaactgctgatgcacggc
aatttcgggctgggcacgttcaacggccttgatggcgagatgatcgtcaatgacagcgta
atccaccagttccgtgcagacgggcaggccggtcgtgtgccgggcgacctcaggactccg
ttcgcctgcgttaccttcttcaacccggagaaggaatacatgatcgacaccgcgcaggat
aaggaaggcttcgaggcgatcgtggatcacctcgtcaacaatcccaacctgttcgccgcc
gtgcgctttaccggcatgttcgagcgggtcgagacccgcaccgtgttctgccagtgccag
ccctacccacccatgctggaagtggtggcccgccagcccaccatgcagcttggtgcctcc
accggcaccatgcttggtttccgcacgccgggctacatgcagggcgtgaacgtggcgggt
tatcacctgcacttcctgactgaggacggacgccgtggcggccatgtgaccgattacggc
gtgctgcgcggtcggcttgaggtgggcgtgatttccgatgtggaaatccagctgccccgc
accgaacagttcgcgcgcgccaacctgtcccccgaaaacattcacgaggccattcgcgtg
gccgagggcggctga

DBGET integrated database retrieval system