KEGG   Gluconacetobacter medellinensis NBRC 3288: GLX_13700Help
Entry
GLX_13700         CDS       T01631                                 

Definition
alpha-acetolactate decarboxylase
Orthology
K01575  
acetolactate decarboxylase [EC:4.1.1.5]
Organism
gxy  Gluconacetobacter medellinensis NBRC 3288
Pathway
Butanoate metabolism
C5-Branched dibasic acid metabolism
Brite
KEGG Orthology (KO) [BR:gxy00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    GLX_13700
   00660 C5-Branched dibasic acid metabolism
    GLX_13700
Enzymes [BR:gxy01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.5  acetolactate decarboxylase
     GLX_13700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1571200..1572114)
Genome map
AA seq 304 aa AA seqDB search
MEIGFNIYWTYEPACITISLQSQMTGLRRCHVPHCPPMQETEVVKLKCYSVGDVDTRSSA
ADSTGVRPRMNRLYQTSTMAALLDAVYDGETTLDELLMHGNFGLGTFNGLDGEMIVNDSV
IHQFRADGQAGRVPGDLRTPFACVTFFNPEKEYMIDTAQDKEGFEAIVDHLVNNPNLFAA
VRFTGMFERVETRTVFCQCQPYPPMLEVVARQPTMQLGASTGTMLGFRTPGYMQGVNVAG
YHLHFLTEDGRRGGHVTDYGVLRGRLEVGVISDVEIQLPRTEQFARANLSPENIHEAIRV
AEGG
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atggaaataggctttaatatatattggacgtacgaacctgcctgcatcaccattagtctg
caatcacaaatgaccgggttgaggcgatgccatgtgccgcattgtcccccgatgcaggag
actgaggtcgtgaagcttaaatgctactcggtaggggatgttgatacccggtccagcgct
gctgattcgactggcgtgcgtccgcgcatgaaccgcctgtaccagacatcgaccatggcc
gcgctgcttgatgcggtctatgatggcgagaccacgcttgatgaactgctgatgcacggc
aatttcgggctgggcacgttcaacggccttgatggcgagatgatcgtcaatgacagcgta
atccaccagttccgtgcagacgggcaggccggtcgtgtgccgggcgacctcaggactccg
ttcgcctgcgttaccttcttcaacccggagaaggaatacatgatcgacaccgcgcaggat
aaggaaggcttcgaggcgatcgtggatcacctcgtcaacaatcccaacctgttcgccgcc
gtgcgctttaccggcatgttcgagcgggtcgagacccgcaccgtgttctgccagtgccag
ccctacccacccatgctggaagtggtggcccgccagcccaccatgcagcttggtgcctcc
accggcaccatgcttggtttccgcacgccgggctacatgcagggcgtgaacgtggcgggt
tatcacctgcacttcctgactgaggacggacgccgtggcggccatgtgaccgattacggc
gtgctgcgcggtcggcttgaggtgggcgtgatttccgatgtggaaatccagctgccccgc
accgaacagttcgcgcgcgccaacctgtcccccgaaaacattcacgaggccattcgcgtg
gccgagggcggctga

DBGET integrated database retrieval system