KEGG   Gluconacetobacter medellinensis NBRC 3288: GLX_14970Help
Entry
GLX_14970         CDS       T01631                                 

Definition
aldose 1-epimerase
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
gxy  Gluconacetobacter medellinensis NBRC 3288
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:gxy00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GLX_14970
   00052 Galactose metabolism
    GLX_14970
Enzymes [BR:gxy01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     GLX_14970
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1715956..1717152
Genome map
AA seq 398 aa AA seqDB search
MRATLPCKSHLLLLATWLLAALPATVAWATPQPVTITRAPFGTLADGQTVEQFTLANGRG
MSVRVMTYGAIITAIDVPDRWGHVADVVLGFPTLEGYVVNNPRGSLYFGATVGRVANRIR
GGSFTLDGRTYHIPQTEGTNALHGGRQGFDRHVWSVETITTTPQAASVTLMRVSPDGEEG
FPGTLTTHVTFGLNTRNELSLHYRATTDRPTVVNLTNHSYFNLGGEGSGSVESEILQIHA
DTFTPVDAQSLPLGTIAPVAGTALDFRMPRRIGAGLRDGGQQMLFQRGYDHNWIVGGTPT
RAPIPAAHLSDPASGRNMDVLTTQPGLQVYTANALDGRYSGPAGHAYRQTDAVALEAEHY
PDSPNHPDFPTITLRPGETYDQTTIYRLGVEPMGHGTP
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgccacgcttccatgtaaaagtcacctccttctgcttgccacatggctgctggca
gcattgcccgccaccgtggcatgggccacaccccaacccgtaaccataacgcgcgcgccc
tttggcacgctggcggacgggcagacagtagagcagttcacgctggctaacggtcggggc
atgagcgtgcgggtcatgacctatggcgcgatcataaccgccattgacgtgcctgaccgc
tgggggcacgtagcggacgtggtgctgggttttcccacactggaaggatacgtggtgaac
aacccgcgcggcagcctgtattttggcgcaactgtagggcgggtggccaaccgcatcaga
ggtggcagctttacgcttgatgggcgcacctaccatattccccagacagaagggaccaac
gccctgcacggcggccgtcagggttttgaccggcatgtctggagcgtggagaccatcacc
accacgccgcaggccgccagcgtgaccctgatgcgggtcagtcccgatggcgaagaaggc
tttcccggcaccctgaccacgcatgtcacatttggcctgaacacgcgcaacgaactgtcg
ctccattaccgcgccaccaccgacaggcccaccgtggtcaacctgaccaaccacagctac
ttcaacctggggggagaggggagcgggtcggtggaaagcgagatcctgcagatccatgca
gatacctttaccccggtagatgcgcagtcactgccactaggcaccatagcgccagtggcg
ggcacagcgctcgatttccgcatgccccggcgcatcggcgcgggcctgcgcgacgggggg
caacaaatgctgttccagcgcggctacgaccataactggatcgtgggcggcacgcccacg
cgggcaccgatccctgccgcccacctgtcagacccggcatcgggccggaacatggacgta
ctgaccacccagcccggcctgcaggtctataccgccaatgcgcttgatgggcgttacagc
gggcctgcggggcacgcctaccgccagacggacgccgtggcactggaggccgaacattat
cctgacagccccaaccacccggatttccctaccatcacccttcggccaggtgaaacctat
gaccagacaaccatttaccgcctgggcgtagaaccgatggggcacggtactccctga

DBGET integrated database retrieval system