KEGG   Gluconacetobacter medellinensis NBRC 3288: GLX_16000Help
Entry
GLX_16000         CDS       T01631                                 

Definition
heptose 7-phosphate kinase/heptose 1-phosphate adenyltransferase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
gxy  Gluconacetobacter medellinensis NBRC 3288
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:gxy00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    GLX_16000
Enzymes [BR:gxy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     GLX_16000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1801529..1802473
Genome map
AA seq 314 aa AA seqDB search
MSSPCTHIAVIGSTNIDFVMHVTRFAQPGETMHVRSSSTGLGGKGANQAMAVARLGQTVA
LAGWTGQDMLADMARTTLEAAGVNTRWLLEDTTCGTGRAFITINAAGQNQILVDGGANMA
HTDASLAHILPALDGAGLVMMQMEMDPTLMLAIARHARAHAIPVMLDPAPVPTDGLPEAL
CALADLITPNERETAALTGIEPTDETTALAAARILHARGVGTAIIKLGHRGVVYSAPDAQ
GFVPPFRVHAIDTVAAGDCFNAGLATALVTGHPLGQAVRIAAACGALATTRAGAAQAAPT
MDEVMTLMATQSVP
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgtccagcccatgtacccatattgccgtgatcggcagcaccaacatcgattttgtcatg
catgtcacccgctttgcccagccaggcgagacgatgcatgtccgttcttcctccaccggt
ctgggtggcaagggcgccaaccaggccatggcggtcgccaggctgggacagacggtggcg
ctggctgggtggaccggccaagacatgctggctgacatggcgcgtacgacactcgaggct
gccggagtgaacacgcgctggctgcttgaagataccacctgcggcacggggcgcgccttc
attaccatcaacgcggcgggtcagaaccagatcctggtggatggtggggccaacatggcc
cataccgacgcatccctggcccatatcctgcccgcgctggacggggccgggctggtcatg
atgcagatggaaatggaccccacgctgatgctggccatcgcccgccacgcccgggcgcat
gccataccggtcatgctggatcccgcgccggttcccaccgatggcctgcccgaagcactc
tgcgcgctggccgatctcatcacccctaacgagcgtgaaaccgccgccctgaccggcatt
gaaccgacggatgagacaaccgccctggccgccgcacgcatcctgcacgcgcgcggcgtg
ggcaccgccatcatcaagctggggcaccggggcgtggtctattccgcccccgatgcacag
ggttttgttccccccttcagggtgcatgccatcgatacagtggcggcgggcgactgcttc
aacgcgggcctggccacggcgctggttacgggtcacccgctggggcaggccgtacggatt
gccgctgcgtgcggtgccctggccaccacgcgggcaggtgccgcgcaggccgcccccacc
atggacgaagtcatgaccctcatggcaacccagtccgtaccatga

DBGET integrated database retrieval system