KEGG   Komagataeibacter medellinensis: GLX_17650Help
Entry
GLX_17650         CDS       T01631                                 

Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
gxy  Komagataeibacter medellinensis
Pathway
gxy00230  Purine metabolism
gxy01100  Metabolic pathways
Module
gxy_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:gxy00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    GLX_17650
Enzymes [BR:gxy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     GLX_17650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_25 AAA_16 AAA_29 RsgA_GTPase AAA_18 AAA_22 AAA_23 ABC_tran APS_kinase AAA_33 MMR_HSR1 Zeta_toxin
Motif
Other DBs
NCBI-ProteinID: BAK84177
UniProt: G2HZR9
Position
complement(1977206..1977868)
Genome map
AA seq 220 aa AA seqDB search
MSPTSIPPRNPATPPVRRRGVCLVISAPSGAGKSTIANALRASEPQLLHSVSITTRQPRP
GESDGIHYHFRSMEEFERMAQAGEMLEWATVFGRGYGTPRAPVEQALAEGRDMVFDIDWQ
GHRQIRAALPDDVISLFVLPPSIAELERRLTGRASDEADEIARRMQAARDEISHWNEFDH
VIINSELDQAIAEARAVLVAARLERHRQVGLAALVAGFGV
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgagcccgacatccatccccccccgtaatccagccaccccgccggtccggcgcaggggg
gtctgtctggttatttcagccccgtccggtgcaggcaagtccaccatcgccaacgcgttg
cgcgcgtccgaaccgcagttgctgcattccgtatcgatcaccacccgccagccccgtcct
ggtgagagcgatggcatccattaccatttccgcagtatggaagagttcgagcgcatggcg
caggcgggcgagatgctggaatgggccaccgtgttcggtcgtggttatggcaccccccgc
gccccggtggagcaggctctggcggaaggccgtgacatggtattcgatattgactggcag
ggccaccggcagatccgcgcggccttgcccgatgatgtgatcagcctgtttgtcctgcca
ccttccatcgcggagctggagcgtcgcctgaccggccgtgcgtcggatgaggccgatgag
atcgcgcgccgcatgcaggccgcgcgcgacgagatctcgcattggaatgaattcgatcac
gtcatcatcaattccgaactagaccaggccatagccgaagcccgtgccgtactggtcgcc
gcccgtctggaacgccaccggcaggttgggcttgcggccctggtggcaggattcggggtc
tga

DBGET integrated database retrieval system