KEGG   Gluconacetobacter xylinus: GLX_17650Help
Entry
GLX_17650         CDS       T01631                                 

Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
gxy  Gluconacetobacter xylinus
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:gxy00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1977206..1977868)
Genome map
AA seq 220 aa AA seqDB search
MSPTSIPPRNPATPPVRRRGVCLVISAPSGAGKSTIANALRASEPQLLHSVSITTRQPRP
GESDGIHYHFRSMEEFERMAQAGEMLEWATVFGRGYGTPRAPVEQALAEGRDMVFDIDWQ
GHRQIRAALPDDVISLFVLPPSIAELERRLTGRASDEADEIARRMQAARDEISHWNEFDH
VIINSELDQAIAEARAVLVAARLERHRQVGLAALVAGFGV
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgagcccgacatccatccccccccgtaatccagccaccccgccggtccggcgcaggggg
gtctgtctggttatttcagccccgtccggtgcaggcaagtccaccatcgccaacgcgttg
cgcgcgtccgaaccgcagttgctgcattccgtatcgatcaccacccgccagccccgtcct
ggtgagagcgatggcatccattaccatttccgcagtatggaagagttcgagcgcatggcg
caggcgggcgagatgctggaatgggccaccgtgttcggtcgtggttatggcaccccccgc
gccccggtggagcaggctctggcggaaggccgtgacatggtattcgatattgactggcag
ggccaccggcagatccgcgcggccttgcccgatgatgtgatcagcctgtttgtcctgcca
ccttccatcgcggagctggagcgtcgcctgaccggccgtgcgtcggatgaggccgatgag
atcgcgcgccgcatgcaggccgcgcgcgacgagatctcgcattggaatgaattcgatcac
gtcatcatcaattccgaactagaccaggccatagccgaagcccgtgccgtactggtcgcc
gcccgtctggaacgccaccggcaggttgggcttgcggccctggtggcaggattcggggtc
tga

DBGET integrated database retrieval system