KEGG   Gluconacetobacter medellinensis NBRC 3288: GLX_18350Help
Entry
GLX_18350         CDS       T01631                                 

Definition
tryptophan synthase subunit alpha
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
gxy  Gluconacetobacter medellinensis NBRC 3288
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:gxy00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    GLX_18350
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    GLX_18350
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    GLX_18350
Enzymes [BR:gxy01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     GLX_18350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2050371..2051207)
Genome map
AA seq 278 aa AA seqDB search
MSRIARRFASLRQQGRGALIPYVEACDPDYDTALAILRGMPGAGADLIEVGVPFSDPSAD
GPTIQKAALRGLKGGSNMKRVLEMVRAFREGNDETPIILMGYTNPIEAYGPERFCVDAHK
AGVDGLIVVDLPPEEADLLAGPAAAVGLDIIRLVAPTTPDARLPVVFNGASGFVYYVSIT
GVTGTRTASTDELAHALPRLRKATDLPIAIGFGIRTPELAANAVRVADAAVVASALLNTL
EGTLDAEGKATARTIPAVLNQLRGLADAVHAVSKTASE
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
gtgagccgcatcgcccgccgctttgccagcctgcgccagcagggccgtggcgccctgatc
ccctatgtcgaggcctgcgaccccgattacgataccgcgcttgccatcctgcgcggcatg
ccgggcgcgggtgccgacctgatcgaggtgggcgtgcccttctccgacccgtccgccgat
ggcccgaccatccagaaggccgccctgcgcgggctgaagggcggctcgaacatgaagcgc
gtgctggaaatggtgcgcgccttccgcgaaggcaatgacgagacgccgatcatcctgatg
ggctacaccaacccgatcgaagcctacgggccggaacgcttctgcgtggatgcacacaaa
gcgggcgtggacgggctgatcgtggtcgacctaccgccggaagaagccgacctgctggca
ggaccagcagcggcagtcgggctagacatcatccgccttgtcgcccccaccacgccggat
gcgcggctgccggtcgtattcaacggcgcatcggggtttgtgtattacgtcagcattacc
ggcgtaaccggcacccgcaccgccagcaccgatgaactggcccacgctctgccgcgccta
cgcaaggcgacggacctgccgattgccatcggttttggcatccgcacgccggaacttgcc
gccaatgccgtgcgcgtggctgatgccgccgttgtggcctccgccctgctcaacacgctt
gagggcacgctggacgcagaggggaaggcgaccgcccgcaccatacccgccgtgctgaac
cagttgcgcggcctggccgatgctgtgcatgctgtcagcaagaccgcctcagaatag

DBGET integrated database retrieval system