KEGG   Gluconacetobacter medellinensis NBRC 3288: GLX_18360Help
Entry
GLX_18360         CDS       T01631                                 

Definition
tryptophan synthase subunit beta
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
gxy  Gluconacetobacter medellinensis NBRC 3288
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:gxy00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    GLX_18360
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    GLX_18360
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    GLX_18360
Enzymes [BR:gxy01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     GLX_18360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2051204..2052433)
Genome map
AA seq 409 aa AA seqDB search
MSATQTPAGTNSLRSGPDHRGRFGIFGGRFVAETLMPLLAELETAYRATQADPEFRRELD
YYLKDYVGRPSPLWFARRMTEELGGAKIYMKREELNHTGSHKLNNVMGQILLARRMGRTR
IVAETGAGQHGVATATVCALFGMKCAIYMGATDVERQKPNVFRMKLLGAEVVPVTAGAGT
LKDAMNEAMRDWVTNVHDTYFLVGTVAGPHPYPEMVRDFQSIIGVETKEQIMEAEGRLPD
AIVAAIGGGSNAMGIFHPFLDDPEVKLIGVEAAGCGLDSGLTAASIERGRPGVLHGNRTY
LMQDEDGQVTEAHSISAGLDYPGVGPEHSWLNDIGRAEYVGATDQDALDAFQLCTRTEGI
IPALESAHAIAYAAKIAPDMAKDKILVVNISGRGDKDIFTVAERLGVKL
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
ttgagcgcaacacagacaccggcaggcaccaacagcctgcgcagcggccctgaccatcgc
ggccgttttggcatttttggcggccgtttcgtggccgagaccctgatgccgctgctggcc
gaactggaaaccgcctaccgggccacccaggcggaccccgaattccgtcgcgagcttgat
tactacctgaaagattacgtaggccgtcccagcccgctgtggttcgcacgccgcatgacc
gaagaacttggcggcgccaaaatctacatgaagcgcgaggagctgaaccataccggctcc
cacaagctcaacaacgtcatggggcagatcctgctggcccgccgcatgggccgcacccgc
atcgtggccgagacgggcgcaggccagcatggtgtggccaccgccaccgtgtgcgcgctg
tttggcatgaaatgcgcgatctacatgggggcgaccgatgtggagcgacagaagcccaac
gtattccgcatgaagctgcttggtgccgaagtggtgccggttaccgcaggtgccggcacg
ctgaaggatgcaatgaacgaggccatgcgcgactgggtaaccaatgtgcatgacacctac
ttccttgtcggcacggtagccggtccgcacccctatcccgagatggtacgcgacttccag
tccatcatcggcgtggaaacgaaagaacagatcatggaagccgaaggccgcctgcccgat
gcgatcgtggcggccattggtggcgggtcgaatgccatgggcatctttcacccgttcctt
gatgaccccgaggtgaagctgatcggcgtggaagccgcaggctgcgggcttgacagtggt
cttaccgccgcctccatcgaacgcgggcgccccggcgtgctgcacggcaaccgcacctac
ctgatgcaggatgaagacggacaggtgaccgaggcgcactccatcagcgccggcctcgac
taccccggcgttgggcccgaacattcatggctcaacgatatcggtcgtgcggaatatgtg
ggggcaaccgatcaggatgctctggacgcctttcagctgtgtacccgcaccgaaggcatc
attcccgcgctggaaagtgcgcatgccatcgcctatgccgcgaagatcgcgccggacatg
gcgaaggacaaaatcctcgtggtcaacatttccggccggggggacaaggacatcttcacc
gtagccgaacgcctgggagtaaaactgtga

DBGET integrated database retrieval system