KEGG   Komagataeibacter medellinensis: GLX_18360Help
Entry
GLX_18360         CDS       T01631                                 

Definition
(GenBank) tryptophan synthase beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
gxy  Komagataeibacter medellinensis
Pathway
gxy00260  Glycine, serine and threonine metabolism
gxy00400  Phenylalanine, tyrosine and tryptophan biosynthesis
gxy01100  Metabolic pathways
gxy01110  Biosynthesis of secondary metabolites
gxy01130  Biosynthesis of antibiotics
gxy01230  Biosynthesis of amino acids
Module
gxy_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:gxy00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    GLX_18360
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    GLX_18360
Enzymes [BR:gxy01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     GLX_18360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: BAK84248
UniProt: G2HZZ0
Position
complement(2051204..2052433)
Genome map
AA seq 409 aa AA seqDB search
MSATQTPAGTNSLRSGPDHRGRFGIFGGRFVAETLMPLLAELETAYRATQADPEFRRELD
YYLKDYVGRPSPLWFARRMTEELGGAKIYMKREELNHTGSHKLNNVMGQILLARRMGRTR
IVAETGAGQHGVATATVCALFGMKCAIYMGATDVERQKPNVFRMKLLGAEVVPVTAGAGT
LKDAMNEAMRDWVTNVHDTYFLVGTVAGPHPYPEMVRDFQSIIGVETKEQIMEAEGRLPD
AIVAAIGGGSNAMGIFHPFLDDPEVKLIGVEAAGCGLDSGLTAASIERGRPGVLHGNRTY
LMQDEDGQVTEAHSISAGLDYPGVGPEHSWLNDIGRAEYVGATDQDALDAFQLCTRTEGI
IPALESAHAIAYAAKIAPDMAKDKILVVNISGRGDKDIFTVAERLGVKL
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
ttgagcgcaacacagacaccggcaggcaccaacagcctgcgcagcggccctgaccatcgc
ggccgttttggcatttttggcggccgtttcgtggccgagaccctgatgccgctgctggcc
gaactggaaaccgcctaccgggccacccaggcggaccccgaattccgtcgcgagcttgat
tactacctgaaagattacgtaggccgtcccagcccgctgtggttcgcacgccgcatgacc
gaagaacttggcggcgccaaaatctacatgaagcgcgaggagctgaaccataccggctcc
cacaagctcaacaacgtcatggggcagatcctgctggcccgccgcatgggccgcacccgc
atcgtggccgagacgggcgcaggccagcatggtgtggccaccgccaccgtgtgcgcgctg
tttggcatgaaatgcgcgatctacatgggggcgaccgatgtggagcgacagaagcccaac
gtattccgcatgaagctgcttggtgccgaagtggtgccggttaccgcaggtgccggcacg
ctgaaggatgcaatgaacgaggccatgcgcgactgggtaaccaatgtgcatgacacctac
ttccttgtcggcacggtagccggtccgcacccctatcccgagatggtacgcgacttccag
tccatcatcggcgtggaaacgaaagaacagatcatggaagccgaaggccgcctgcccgat
gcgatcgtggcggccattggtggcgggtcgaatgccatgggcatctttcacccgttcctt
gatgaccccgaggtgaagctgatcggcgtggaagccgcaggctgcgggcttgacagtggt
cttaccgccgcctccatcgaacgcgggcgccccggcgtgctgcacggcaaccgcacctac
ctgatgcaggatgaagacggacaggtgaccgaggcgcactccatcagcgccggcctcgac
taccccggcgttgggcccgaacattcatggctcaacgatatcggtcgtgcggaatatgtg
ggggcaaccgatcaggatgctctggacgcctttcagctgtgtacccgcaccgaaggcatc
attcccgcgctggaaagtgcgcatgccatcgcctatgccgcgaagatcgcgccggacatg
gcgaaggacaaaatcctcgtggtcaacatttccggccggggggacaaggacatcttcacc
gtagccgaacgcctgggagtaaaactgtga

DBGET integrated database retrieval system