KEGG   Gluconacetobacter xylinus: GLX_19730Help
Entry
GLX_19730         CDS       T01631                                 

Definition
succinate dehydrogenase membrane anchor subunit
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
gxy  Gluconacetobacter xylinus
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Succinate dehydrogenase, prokaryotes
Class
Metabolism; Overview; Carbon metabolism [PATH:gxy01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:gxy00020]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:gxy00650]
Metabolism; Energy metabolism; Oxidative phosphorylation [PATH:gxy00190]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2195592..2196023)
Genome map
AA seq 143 aa AA seqDB search
MSNMKKPHITVMRSQLSRARGLGSGQAGVGHWWAERASAVALVPLSGWFVIQVFRLAGAS
QPEVAKWGAHPFNTTMMLSLVILTFYHTQLGLQVIIDDYVHGKAHLPAGLLMKGIVFLLG
LFGTVSVLKLALAGSTKGQVAAG
NT seq 432 nt NT seq  +upstreamnt  +downstreamnt
atgagcaatatgaagaagccacatatcacggtcatgcgttcccagctttcgcgggcacgc
ggcctgggctcgggtcaggccggtgttggccactggtgggcggaacgtgcatcggcggtg
gcccttgtgccgctgtcgggctggttcgtgatccaggtgttccgtctggcgggcgcatcc
cagccggaagtggcgaagtggggcgcgcatccattcaacacgaccatgatgctgtcgctg
gtgatcctgaccttctaccacacccagcttgggctgcaggtcatcattgatgactacgtg
cacggcaaggcgcacctgcccgcagggctgctgatgaaggggatcgtcttccttctgggg
ctgttcggcacggtttccgtactgaagctggcccttgccggcagcacgaaggggcaggtt
gccgcgggctga

DBGET integrated database retrieval system