KEGG   Gluconacetobacter medellinensis NBRC 3288: GLX_19830Help
Entry
GLX_19830         CDS       T01631                                 

Definition
2-oxoglutarate dehydrogenase E2 component
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
gxy  Gluconacetobacter medellinensis NBRC 3288
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:gxy00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    GLX_19830
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    GLX_19830
  Amino acid metabolism
   00310 Lysine degradation
    GLX_19830
Enzymes [BR:gxy01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     GLX_19830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2206392..2207648
Genome map
AA seq 418 aa AA seqDB search
MSAEIKVPTLGESVTTATVAKWLKHPGDAVNEDEPLVELETDKVSVEVPAPQAGVLGPLL
VPEGEEVEVGTVLSTIEVGSGAAPKPAAAPAPKKETPTGVQAQPTASGPVARPATPASDI
AAQGAAAVAFPAARKIMAEQGVSPAQVGTGTGKDGRITKGDVQSFLAQPRAAQPAAAPRP
PRQDDPREERVKMTRLRRTIARRLKDAQNTAALLTTFNEVDMSGVMQMRAEYKDLFIKKH
NGVKLGFMSIFSRAVIAALQEFPAINAEIDGDDVIYREFVNLGIAVGGPNGLVVPVIRDA
DKMGFAQIESAIAGFGKKAREGTLKIDELSGGTFSITNGGIYGSLMSTPIINAPQSAILG
MHAIQDRPVAVNGQVVIRPMMYIALTYDHRIVDGKEAVSFLVRVKQNVEDPRRLLLQV
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgtctgccgagatcaaggtaccgacactgggtgaaagtgttaccacagcaaccgttgcc
aagtggctgaagcatccgggtgatgcggtgaacgaagatgagccgttggtggaactggaa
accgacaaggtcagcgtggaagtccccgctccgcaggccggtgtgcttggcccgctgctg
gtgcccgagggcgaggaagtggaagtcggtaccgtgctgtccaccattgaagttggtagc
ggcgccgcccccaaaccggcagccgcccccgcccccaagaaggagacccccaccggcgtg
caggcccagcccacggccagcggtccggtcgcccgtccggccaccccggcatctgacatt
gcggcacagggtgcggctgccgtagccttcccagccgcgcgcaagatcatggccgagcag
ggtgtctcccccgcccaggtcggtaccggcaccggcaaggatggtcgtatcaccaagggt
gacgtgcagagctttcttgcccagccgcgcgcggcccagcccgctgctgccccgcgcccg
ccgcgtcaggatgacccgcgtgaggaacgcgtgaagatgacgcgcctgcgccgcaccatt
gcgcgccgcctgaaagacgctcagaacaccgcagccctgctgacgacgttcaatgaagtg
gacatgtccggcgtgatgcagatgcgcgccgagtacaaggacctgttcatcaagaagcat
aacggcgtgaagctgggcttcatgtccatcttcagccgtgcggtcattgcggcactgcag
gagttcccggccatcaatgccgagatcgacggcgatgacgtgatttatcgtgagttcgtc
aacctcggcattgccgtgggtggtcccaacggtctggtcgtgcccgtgatccgcgatgcc
gacaagatgggcttcgcccagatcgaaagcgcgattgcaggctttggcaagaaggcgcgc
gaaggcacgctgaagatcgatgaactgtccggtggtacgttctcgatcaccaatggcggc
atttatggctcgctcatgtccacacccatcatcaacgcgccgcagtcggccatccttggc
atgcacgccattcaggaccgaccggttgccgtgaacgggcaggtggtgatccgtccgatg
atgtatatcgcgctgacctatgaccaccggatcgtggacggcaaggaggcagtgagcttc
cttgtgcgggtcaagcagaacgtggaagatccgcgccgtctgctgctgcaggtctga

DBGET integrated database retrieval system