KEGG   Gluconacetobacter medellinensis NBRC 3288: GLX_25040Help
Entry
GLX_25040         CDS       T01631                                 

Definition
endo-1,4-beta-glucanase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
gxy  Gluconacetobacter medellinensis NBRC 3288
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gxy00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    GLX_25040
Enzymes [BR:gxy01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     GLX_25040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2768782..2769861
Genome map
AA seq 359 aa AA seqDB search
MLLDFMKLQKQVSGMERRSFLSVMAAVGSMSFISSAVAADDPVINAQWAIFRTKYFHADG
RIIDTGNSGESHSEGQGYGMLFAATAGDQTTFEALWAWTRTNLQHKTDKLFSWRYLDGHN
PPVADKNNATDGDLLIALGLVRAGKRWDRADYIQDAIAIYGDVLKLMTMQVGPYKVLLPG
GVGFVNKDSVTLNLSYYVMPSLMQAVALSGDAGWQKVIADGLLIIGQARFGEWKLPPDWI
SINRQSVHVSIAKGWPPRFSYDAIRVPLYLYWAHMLSPELLAGYANFWNHFGASALPGWV
DLTNGTRSPYNAPPGYLAVATCSGLASAGGLPTLNNAPDYYSAALTLLVYIARGEGGGM
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgctgttggattttatgaagctgcaaaaacaggtatccggaatggaacgtcgttctttt
ctgtctgtcatggcggcagttggcagtatgtcgttcatttcttccgcagttgcagcagat
gaccctgtcataaacgcccagtgggccattttccgcacaaaatattttcatgccgatggc
cggattatcgataccggcaatagtggtgagtcccatagtgaagggcagggctacggcatg
ctcttcgccgcaaccgcaggcgaccagactacgttcgaagccctgtgggcctggacacgt
accaacctgcaacacaagaccgacaagctgttttcctggcgctaccttgatgggcacaat
ccgccggtagccgacaagaataatgcgaccgatggtgatctgctgattgcgctgggtctg
gtacgcgccgggaagcgttgggacagggccgactatattcaggacgctattgccatctat
ggtgatgtgctgaagctcatgaccatgcaggtcgggccctataaggtcctgctccctggc
ggtgtgggtttcgtgaataaggattcggttacgcttaacctgtcctactacgtcatgccc
tccctcatgcaggcggttgcgctgtctggtgatgcaggctggcagaaggtgatagcggac
gggctcctaatcatcggtcaggcccgattcggggaatggaagcttccaccggattggatt
tcgatcaatcgacagagcgtgcatgtctccatcgccaaggggtggccgccacgtttctcc
tatgatgcgattcgtgtgccgctgtacctttactgggcccatatgctttccccggaactg
ctggctggctatgcaaacttctggaaccatttcggcgcgtccgccctgccgggctgggtc
gatctgaccaacgggactcgttcgccttacaacgcgccgccagggtatcttgctgtagca
acgtgttccggcctggcgtctgccggtgggttaccgacgctgaacaatgcgccggattat
tattctgctgccctgacattgctggtttatattgcccgtggcgagggagggggaatgtga

DBGET integrated database retrieval system