KEGG   Komagataeibacter medellinensis: GLX_25040Help
Entry
GLX_25040         CDS       T01631                                 

Definition
(GenBank) endo-1,4-beta-glucanase
  KO
K20542  
endoglucanase [EC:3.2.1.4]
Organism
gxy  Komagataeibacter medellinensis
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2768782..2769861
Genome map
AA seq 359 aa AA seqDB search
MLLDFMKLQKQVSGMERRSFLSVMAAVGSMSFISSAVAADDPVINAQWAIFRTKYFHADG
RIIDTGNSGESHSEGQGYGMLFAATAGDQTTFEALWAWTRTNLQHKTDKLFSWRYLDGHN
PPVADKNNATDGDLLIALGLVRAGKRWDRADYIQDAIAIYGDVLKLMTMQVGPYKVLLPG
GVGFVNKDSVTLNLSYYVMPSLMQAVALSGDAGWQKVIADGLLIIGQARFGEWKLPPDWI
SINRQSVHVSIAKGWPPRFSYDAIRVPLYLYWAHMLSPELLAGYANFWNHFGASALPGWV
DLTNGTRSPYNAPPGYLAVATCSGLASAGGLPTLNNAPDYYSAALTLLVYIARGEGGGM
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgctgttggattttatgaagctgcaaaaacaggtatccggaatggaacgtcgttctttt
ctgtctgtcatggcggcagttggcagtatgtcgttcatttcttccgcagttgcagcagat
gaccctgtcataaacgcccagtgggccattttccgcacaaaatattttcatgccgatggc
cggattatcgataccggcaatagtggtgagtcccatagtgaagggcagggctacggcatg
ctcttcgccgcaaccgcaggcgaccagactacgttcgaagccctgtgggcctggacacgt
accaacctgcaacacaagaccgacaagctgttttcctggcgctaccttgatgggcacaat
ccgccggtagccgacaagaataatgcgaccgatggtgatctgctgattgcgctgggtctg
gtacgcgccgggaagcgttgggacagggccgactatattcaggacgctattgccatctat
ggtgatgtgctgaagctcatgaccatgcaggtcgggccctataaggtcctgctccctggc
ggtgtgggtttcgtgaataaggattcggttacgcttaacctgtcctactacgtcatgccc
tccctcatgcaggcggttgcgctgtctggtgatgcaggctggcagaaggtgatagcggac
gggctcctaatcatcggtcaggcccgattcggggaatggaagcttccaccggattggatt
tcgatcaatcgacagagcgtgcatgtctccatcgccaaggggtggccgccacgtttctcc
tatgatgcgattcgtgtgccgctgtacctttactgggcccatatgctttccccggaactg
ctggctggctatgcaaacttctggaaccatttcggcgcgtccgccctgccgggctgggtc
gatctgaccaacgggactcgttcgccttacaacgcgccgccagggtatcttgctgtagca
acgtgttccggcctggcgtctgccggtgggttaccgacgctgaacaatgcgccggattat
tattctgctgccctgacattgctggtttatattgcccgtggcgagggagggggaatgtga

DBGET integrated database retrieval system