KEGG   Gluconacetobacter medellinensis NBRC 3288: GLX_25810Help
Entry
GLX_25810         CDS       T01631                                 

Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
gxy  Gluconacetobacter medellinensis NBRC 3288
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gxy00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    GLX_25810
Enzymes [BR:gxy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     GLX_25810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2857284..2858441
Genome map
AA seq 385 aa AA seqDB search
MKTVSVLGSTGSIGCSTVDLLLQAPDQFRTGALVGGRNVARLAEQARALGAQRAVIADEG
LLPELETLLAGSGVETAGGRAAVIEAAALPVDWTMAAITGATGLEPTLAAVRNGTHVALA
NKEALVCAGDVMLRAVEAAGATLLPVDSEHNAVFQSMADKQVDQVEKIILTASGGPFRRA
SLEEMEKAPLEAALKHPTWSMGAKITIDSATMFNKGLELIEAARLFNVTEDRLDVVVHPQ
SIVHSMVQYTDGSVVAQLGSADMRIPIAHTLAWPKRMPTNSPRLDLAALSRLDFEAPDEV
RFPALRLARESLRAGGAMPAILSGANEIAVEAFLKREIGFLDIARIVEDVMHSIGAQRAD
TLEEVLHWDAESRRVARLHTVARAA
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgaagacagtttccgttctgggcagcacgggcagcattggctgttctacggtggacctg
ctgctgcaggcacctgatcagttccgcactggtgcgctggtcggtggccgcaatgtggcc
aggctggcggagcaggcccgcgcactgggtgcgcagcgggccgtcattgccgatgaaggg
ttgctgccggaactggaaaccctgcttgcgggcagcggcgtggagacggccggtggccgt
gccgccgtgatcgaggcggcagccctaccggtggactggaccatggcagctattaccggt
gccaccgggctggagccgacgctggcggcggtgcgcaatggtacccatgtggcgctggcc
aacaaggaggcgctggtctgcgcgggtgatgtgatgctgcgtgccgtggaggcggcgggg
gccacgctgctgccggtcgattccgagcataacgccgtattccagtccatggccgacaag
caggtggaccaggtcgagaagattatcctgacggcatcgggcggcccgttccgtcgggca
agtcttgaggaaatggaaaaggccccgctagaagctgccctgaaacacccgacatggagc
atgggggccaagatcaccatcgattccgccaccatgttcaataagggactggaactgatc
gaggcggcgcgcctgttcaacgtgaccgaagacaggctggatgtggtcgttcacccgcaa
tctatcgtgcacagcatggtgcagtataccgatggttcggttgtggcccagcttggctcg
gccgatatgcgcattcccatcgcccacacgctggcctggccgaagcgcatgcctaccaat
tcaccccgacttgaccttgcggcgctgtcgcggctggatttcgaggcacctgatgaggtc
cgcttccccgcgctgcgccttgcgcgcgaatccctgcgtgcggggggtgccatgcctgcc
attctgtccggcgccaatgaaattgcggtcgaggcgttcctgaagcgtgaaatcgggttc
ctggatattgcgcgtattgtggaggatgtcatgcactccatcggcgcgcagcgggccgat
acgctggaagaagtgctgcactgggatgcggaatcgcgccgtgtcgcacgcctccacacg
gttgcccgcgcggcctga

DBGET integrated database retrieval system