KEGG   Gluconacetobacter xylinus: GLX_25970Help
Entry
GLX_25970         CDS       T01631                                 

Definition
acetylornithine deacetylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
gxy  Gluconacetobacter xylinus
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:gxy01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:gxy00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2872633..2873805
Genome map
AA seq 390 aa AA seqDB search
MADGAVMDADQDPGGAVSLARDLIRCPSVTPDDGCAISALARVLEGIGFSVTLLPFGEGT
ARTPNLFARLGTGQPHVCFAGHTDVVPVGNAAQWSHDPFGGEIHDGILFGRGACDMKGGI
AAFVAAVRLYLGKVGTPQGSISLLITGDEEGPATNGTVRVLEWMAEHGQIPGFCLVGEPT
NPAGMGEMIKIGRRGSLNARIVVPGTQGHVAYPHRADNPVHRLLALLGELTVAPLDGGSD
WFDASSLQVTSLDVGNTATNVIPAQAEARLNIRFNDLHTGADLAGWIRTVVARHAPRARV
DISVSGESFLTEPGAPVEALRASVRAVTGQVPRLDTGGGTSDARFIARYCDVAEFGLVGA
SMHKTDEHVTVADLRQLTAIYTGFLEKVMH
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atggcggatggcgcagtaatggatgcggatcaggatcccggtggggctgtcagccttgcg
cgtgatctgatccgctgcccgtccgtaacaccggatgatggctgtgccatcagtgccctg
gctagggtgctggaaggtattggcttcagcgtgaccctgctgccattcggggaggggacg
gcccgtaccccgaacctgttcgcccggctgggtacggggcagccccatgtgtgctttgcc
ggacatacggatgtcgtgccggtggggaacgcggcacagtggagccacgatccctttggc
ggcgagatccacgatggcatcctgttcggccggggcgcgtgtgacatgaaggggggcatt
gccgccttcgttgccgccgtccggctgtatctggggaaggtgggcacgccgcagggatca
atcagcctgctcattaccggtgatgaggaaggccccgccaccaacggcaccgtacgcgtg
ctggaatggatggcagaacatggccagatccccggtttctgcctggtgggggaaccgacc
aatcccgccggtatgggggaaatgatcaagatcggccgccggggtagtctcaatgcccgc
atcgtggtaccgggcacgcaggggcatgtggcctatccgcaccgggccgacaacccggtt
caccggcttctggccctgctaggggaactgacggtcgctccgctggacgggggcagtgac
tggttcgatgcttccagcctgcaggtcaccagccttgacgtgggcaacacagccaccaat
gtcatccctgcacaggcagaagcccggctgaacatccgcttcaatgacctgcataccgga
gccgaccttgcgggttggattcgtacggtggtggcacgccacgccccccgggcgcgggtg
gatatatccgtaagcggcgaatccttcctgaccgaaccgggcgccccggtggaggccttg
cgcgccagtgtgcgcgccgtgactgggcaggtgccccggctggatacaggtggcggcacg
tccgatgcccgcttcattgcccgttattgcgatgttgcggagttcgggttggtgggggcc
agcatgcacaagaccgacgagcatgttactgtggcggacctgcgacagttgacggcgatc
tataccgggtttcttgaaaaggtaatgcattga

DBGET integrated database retrieval system