KEGG   Komagataeibacter medellinensis: GLX_26260Help
Entry
GLX_26260         CDS       T01631                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
gxy  Komagataeibacter medellinensis
Pathway
gxy00260  Glycine, serine and threonine metabolism
gxy00750  Vitamin B6 metabolism
gxy01100  Metabolic pathways
gxy01110  Biosynthesis of secondary metabolites
gxy01120  Microbial metabolism in diverse environments
gxy01230  Biosynthesis of amino acids
Module
gxy_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:gxy00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    GLX_26260
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    GLX_26260
Enzymes [BR:gxy01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     GLX_26260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N PALP
Motif
Other DBs
NCBI-ProteinID: BAK85038
UniProt: G2I2Q9
Position
complement(2907161..2908567)
Genome map
AA seq 468 aa AA seqDB search
MRYISTRGNAPVRDFSSVLLAGLAEDGGLYLPESWPELTLPQWRDLRGLPYPELAARIIA
PFAEGSITHDVLLKLCREAYSRFDHPAIVPLTQVEDGLFVQELFHGPTLAFKDMAMQLLG
RLFDHVLTERDEKVTIVGATSGDTGSAAIEACRGRARLNVVILHPEGRTSEVQRRQMTTV
LEPNVTNLAVQGTFDDCQDLVKAMFADLPFRTDMHLSAVNSINWARIAAQVPYYVYAALA
LGAPDREVSFAVPTGNFGNVLAAWVARRMGLPIRALCVGSNRNDILSRFLNENDMSIHGV
VPSLSPSMDIQVSSNFERLLFELLDRNAGECARIMTDFRKTGVMKVSTPVWDRANALFHG
LSLDDGATEAEIRMLNTRSHYLADPHTAIGIAAGRAFREAGIPMVAMSTAHPAKFPDAMA
QATGIRPALPAALADLYDRPERYSVVPANLGVIEDRVRAAVLSNTPAD
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atgcgctatatttctacccgggggaatgcccccgtccgcgacttttcgtccgttctgctg
gcggggctggcagaggacggtggcctgtacctgcccgaaagctggcccgaactcacgctc
ccccagtggcgtgacctgcgcggcctgccctacccggagcttgccgcccgcatcatcgcg
ccctttgccgaagggtcgatcacacatgatgtgctgctcaagctgtgccgtgaagcctac
agccgattcgaccaccccgcgatcgtgccgctgacacaggtggaagacgggcttttcgtg
caggaactgttccacggccccacgctggccttcaaggacatggccatgcagttgcttggc
cgcctgtttgaccatgtgctgaccgagcgtgacgagaaggtcacgatcgtgggtgccaca
tcgggtgataccggatcggccgcgattgaggcatgccggggccgcgcgcggctgaacgtg
gtgatcctgcaccccgaaggccgcacgtcagaagtgcagcgccgacagatgaccaccgtg
ctggaacccaacgtaaccaacctggccgtgcagggcacattcgatgactgccaggatctg
gtcaaggccatgtttgccgacctgcccttccgcaccgacatgcatctctcggcggtcaat
tccatcaactgggcgcgcattgcagcgcaggtgccttactatgtctatgccgcacttgca
ctgggcgcaccggatcgcgaagtctcgtttgccgtgcccaccggcaatttcggcaacgtg
ctggccgcatgggtggcgcgccgcatgggtctgcccatccgcgcgctgtgcgtcggctcc
aaccggaacgacatcctctcgcgcttcctcaatgaaaacgacatgagcatccacggcgtg
gtgcccagcctgtcgccttcgatggatattcaggtctcatccaacttcgagcgcctgctg
ttcgaactgctggaccgcaatgcgggcgaatgcgcgcgcatcatgaccgatttccgcaag
accggcgtgatgaaggtctccaccccggtatgggaccgggccaatgcgctgttccacggc
ctgtcgctggatgatggagcaacagaggcggaaatccgcatgctcaacacccgcagccac
tacctggctgacccgcacacggccatcggcatagcggcggggcgcgctttccgtgaggcc
gggattcccatggtcgccatgtccacggcccaccccgccaagttccccgatgccatggca
caggcaaccggcatccgccctgccctgcctgccgccttggctgacctgtatgaccgtccc
gagcgttacagcgtggtacccgccaatctgggcgtgatcgaggacagggtacgcgctgcc
gtcctgtccaacacgcctgccgactga

DBGET integrated database retrieval system