KEGG   Gluconacetobacter medellinensis NBRC 3288: GLX_26370Help
Entry
GLX_26370         CDS       T01631                                 

Definition
uroporphyrinogen-III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
gxy  Gluconacetobacter medellinensis NBRC 3288
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gxy00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    GLX_26370
Enzymes [BR:gxy01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     GLX_26370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2924810..2925520
Genome map
AA seq 236 aa AA seqDB search
MRDGVIVTRPPPGLAPTMAAVAGAGWRPIAAPMLHVSQRALSIGTVRPDAIMMTSGQAIA
SLKVSRLHDVPCYVVGSATARRARAAGFINVFAASGTADDLTALVRAVLPPPARLLLAVG
QGYGQEMAVALRGYGYRVWRRCVYGVRAAPVLPSDALAALLAGRVAAAMFYSTRTASAFM
AAMPPAVVPLLAEVAAIAMSGGVADALGAGPCWRRIHIAARADQEAMLACLPAIMD
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgacggggtgatcgtgacccgccccccgcccggcctggcccccaccatggcggca
gtggcgggggcagggtggcgacccattgccgcccccatgctgcatgtcagccagcgcgcc
ctttccatcgggacagttcgtcctgacgccatcatgatgaccagcggccaggccattgcc
agcctcaaggtgtcccggttgcatgatgtcccttgctatgtagtggggtctgctaccgca
cggcgtgcccgtgcggcaggatttatcaatgtctttgccgcatccggcacggcggatgac
ctgaccgcgctggtgcgggcggtcctgccacccccggcccggttgttgctggcggtgggg
cagggatacgggcaggagatggcggtggcattgcgcgggtatggctaccgggtgtggcgg
cggtgcgtttatggtgtgcgcgcggcgccagtcctgccatctgatgcgcttgcagccctg
ctggcggggcgggtggcggcggccatgttctattccacccgcacggcgtcagccttcatg
gcggccatgccgcctgcggttgtacccctgctggcggaggtggcggccattgccatgtcc
ggtggggtggccgacgcccttggtgcggggccgtgctggcggcgcatccatattgccgcc
cgggccgatcaggaagccatgctggcctgcctgcctgccatcatggactga

DBGET integrated database retrieval system