KEGG   Gluconacetobacter medellinensis NBRC 3288: GLX_26420Help
Entry
GLX_26420         CDS       T01631                                 

Definition
cytochrome c peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
gxy  Gluconacetobacter medellinensis NBRC 3288
Brite
Enzymes [BR:gxy01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     GLX_26420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2929284..2930696
Genome map
AA seq 470 aa AA seqDB search
MSVRKAVLGIIAAGGVAYGGTVAYLTHFDHATAPAPAGAGVDAVSANALNVVREARCDYC
HAANVSLPFYFSLPVANTLMNRDRAEGLKHFRVEPVITALQNGSVPDEEPLARIEEVINQ
NRMPPTLYLLMHWHAHLSAAQRGSMLAWIAQVRRQHYATSGVADRFAAEPVQPIPESVPV
DAAKVALGQRLFFDRHLSGDGQSNCASCHSLQHGGVDGLVTATGIYGQKGPINVPTVFDA
VFNKSQFWNGRAATLADQAAGPVMNPVEMGSHDWSDVAAHLREDPSYVTDFQAAFGSDTI
DQATITEAIAEYEKTLITPDSRFDQYLKGDDAALNTQEKQGYRLFKEIGCSGCHTGVSMG
GQAFEPMGLEANYFAARGGALTDADKGRFTVTHNAADMERFKVPNLRNIALTAPYFHDGS
VKTLEDAVRKMARYQTPDHSISDQDVADIVAFLNTLTGRYQGEILHNTAP
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atgtcggtcaggaaggcagttctggggataatagccgcaggcggcgtggcgtatggaggc
acggttgcctatctcacgcatttcgatcatgccacggcgccagcccccgcgggggctggg
gtggatgcggtctccgccaatgcgctgaacgtggtgcgggaggcgcgctgcgattactgc
catgcggccaatgtcagcctgcccttctatttcagcctgccggtggctaatacgctcatg
aaccgcgaccgggcggaagggctgaagcacttccgtgtggaaccggtcattaccgcgtta
cagaacggtagcgtgcccgatgaggagccactggcccgcatcgaggaagtgatcaaccag
aatcgtatgccgcccacgctgtacctgctcatgcactggcacgcccacctgtcggctgcc
cagcgtgggagcatgctggcgtggattgcccaggtgcgtcgccagcattacgcaacatcg
ggcgttgccgaccgctttgcggccgaaccggtacagcccatacccgaatccgtgccggtc
gatgcagccaaggttgcgctgggtcagcgcctgttctttgaccggcacctttcgggcgat
gggcagtccaactgcgcaagctgccacagcctgcagcacggtggtgtggatggtcttgtc
acggcaacaggcatttatggccagaagggcccgatcaatgtgccgaccgtgtttgatgcg
gtattcaacaagagccagttctggaacggacgcgccgcaacactggctgatcaggcggca
ggcccggtcatgaatccggtggaaatggggtcgcatgactggtcggatgtggcagctcac
ctgcgtgaagatccgtcctatgtcacggatttccaggcagcctttggcagcgacacgatc
gaccaggccaccattaccgaggcgatcgcggaatatgaaaagaccctgatcacgcctgac
agccgctttgaccagtacctcaagggtgacgatgccgccctgaacacacaggaaaagcag
ggctacagactgttcaaggagattggttgctccggctgccacacaggcgtctccatgggt
gggcaggccttcgagccgatggggctggaagccaattacttcgccgcccgcggcggtgcc
ctgaccgatgcggacaagggacgctttacggttacgcataacgcggcggacatggaacgc
ttcaaggtgcccaacctgcgcaacattgcgctgaccgcgccgtatttccatgatggtagc
gtgaagacgctggaggatgccgtgcgcaaaatggcgcgctaccagacgccagaccacagc
atttccgatcaggacgtggctgatatcgtggcattcctcaacaccctgaccgggcgctat
cagggcgagatactgcataacaccgcaccctga

DBGET integrated database retrieval system