KEGG   Gluconacetobacter xylinus: GLX_27370Help
Entry
GLX_27370         CDS       T01631                                 

Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
gxy  Gluconacetobacter xylinus
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Class
Metabolism; Overview; Carbon metabolism [PATH:gxy01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:gxy00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:gxy00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:gxy00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:gxy00520]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:gxy00521]
Metabolism; Biosynthesis of other secondary metabolites; Butirosin and neomycin biosynthesis
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3037895..3038863
Genome map
AA seq 322 aa AA seqDB search
MKEIVAVDIGGTHARFAIAQVDQGRVVTLGEAVTLKCADHASLQLAWEAFARVIDRPLPK
SAGIAVACPIKGDILKLTNNPWVIQPAWLPVKLGVDELILVNDFGAVAHAVAQVGEGSLQ
HICGPDVPLPEQGVITVVGPGTGLGSAYVVRRKNGYFVCETEGGHIDFSPLDQLEDRILT
VLRRRYRRVSVERVVSGPGLLNLYEAIAEMGELSVKARDDKALWTMALEGSDPVAAAALE
RFCLSLGTVAGDLALAQGGSAVVIAGGLGLRLAKHLPSSGFAERFVAKGRFEGMMSEMPV
KLITYPQPGLLGAAAAFAEAYR
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgaaagagatcgtagcagttgatattggcgggacgcatgcccgtttcgccattgcccag
gtagaccagggtcgggttgtcacgctgggggaagccgtgaccctgaaatgcgccgatcat
gccagcctgcaactggcatgggaagcctttgcccgcgtaatcgaccgcccgctacccaag
tcggctggcattgctgtggcgtgtcccatcaagggtgatatcctcaagctgaccaacaac
ccgtgggtgatccagcccgcgtggctgccggtcaagctgggggtggacgaactgatcctt
gtcaatgattttggggccgtggcccacgcagtggcgcaggtaggggaaggcagcctccag
catatctgcgggcctgacgtacccctgcccgaacagggcgtcataaccgtggtgggaccg
ggcaccggactgggttcagcctatgtcgtgcgccgcaagaacggctacttcgtatgcgag
accgagggcgggcatatcgacttctccccgcttgaccagttggaagaccgtattctgact
gtgctgcgccgccgctaccgccgcgtatcggtcgagcgtgtggtatccgggccgggcctg
ctgaacctgtatgaggcgattgccgagatgggtgagctttcggtcaaggcgcgtgatgac
aaggcactgtggaccatggcgctggaaggctccgaccctgtagctgctgccgcgctggag
cgtttctgccttagcctgggcacggttgcgggcgacctggccctggcacaggggggcagc
gcggtggtgattgctggcgggcttggcctgcgtctggccaagcacctgcccagttccggt
tttgccgagcgttttgtagccaagggtcgctttgaaggcatgatgtcggaaatgccggtc
aagctgatcacctacccgcagcccggcctgctcggtgccgccgcagcctttgcagaagcc
taccgctaa

DBGET integrated database retrieval system