KEGG   Komagataeibacter medellinensis: GLX_27370Help
Entry
GLX_27370         CDS       T01631                                 

Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
gxy  Komagataeibacter medellinensis
Pathway
gxy00010  Glycolysis / Gluconeogenesis
gxy00052  Galactose metabolism
gxy00500  Starch and sucrose metabolism
gxy00520  Amino sugar and nucleotide sugar metabolism
gxy00521  Streptomycin biosynthesis
gxy01100  Metabolic pathways
gxy01110  Biosynthesis of secondary metabolites
gxy01120  Microbial metabolism in diverse environments
gxy01130  Biosynthesis of antibiotics
gxy01200  Carbon metabolism
Module
gxy_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:gxy00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GLX_27370
   00052 Galactose metabolism
    GLX_27370
   00500 Starch and sucrose metabolism
    GLX_27370
   00520 Amino sugar and nucleotide sugar metabolism
    GLX_27370
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    GLX_27370
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    GLX_27370
Enzymes [BR:gxy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     GLX_27370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase ROK
Motif
Other DBs
NCBI-ProteinID: BAK85149
UniProt: G2I3I2
Position
3037895..3038863
Genome map
AA seq 322 aa AA seqDB search
MKEIVAVDIGGTHARFAIAQVDQGRVVTLGEAVTLKCADHASLQLAWEAFARVIDRPLPK
SAGIAVACPIKGDILKLTNNPWVIQPAWLPVKLGVDELILVNDFGAVAHAVAQVGEGSLQ
HICGPDVPLPEQGVITVVGPGTGLGSAYVVRRKNGYFVCETEGGHIDFSPLDQLEDRILT
VLRRRYRRVSVERVVSGPGLLNLYEAIAEMGELSVKARDDKALWTMALEGSDPVAAAALE
RFCLSLGTVAGDLALAQGGSAVVIAGGLGLRLAKHLPSSGFAERFVAKGRFEGMMSEMPV
KLITYPQPGLLGAAAAFAEAYR
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgaaagagatcgtagcagttgatattggcgggacgcatgcccgtttcgccattgcccag
gtagaccagggtcgggttgtcacgctgggggaagccgtgaccctgaaatgcgccgatcat
gccagcctgcaactggcatgggaagcctttgcccgcgtaatcgaccgcccgctacccaag
tcggctggcattgctgtggcgtgtcccatcaagggtgatatcctcaagctgaccaacaac
ccgtgggtgatccagcccgcgtggctgccggtcaagctgggggtggacgaactgatcctt
gtcaatgattttggggccgtggcccacgcagtggcgcaggtaggggaaggcagcctccag
catatctgcgggcctgacgtacccctgcccgaacagggcgtcataaccgtggtgggaccg
ggcaccggactgggttcagcctatgtcgtgcgccgcaagaacggctacttcgtatgcgag
accgagggcgggcatatcgacttctccccgcttgaccagttggaagaccgtattctgact
gtgctgcgccgccgctaccgccgcgtatcggtcgagcgtgtggtatccgggccgggcctg
ctgaacctgtatgaggcgattgccgagatgggtgagctttcggtcaaggcgcgtgatgac
aaggcactgtggaccatggcgctggaaggctccgaccctgtagctgctgccgcgctggag
cgtttctgccttagcctgggcacggttgcgggcgacctggccctggcacaggggggcagc
gcggtggtgattgctggcgggcttggcctgcgtctggccaagcacctgcccagttccggt
tttgccgagcgttttgtagccaagggtcgctttgaaggcatgatgtcggaaatgccggtc
aagctgatcacctacccgcagcccggcctgctcggtgccgccgcagcctttgcagaagcc
taccgctaa

DBGET integrated database retrieval system