KEGG   Gluconacetobacter medellinensis NBRC 3288: GLX_27710Help
Entry
GLX_27710         CDS       T01631                                 

Definition
dTDP-4-dehydrorhamnose 3,5-epimerase
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
gxy  Gluconacetobacter medellinensis NBRC 3288
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gxy00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    GLX_27710
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    GLX_27710
Enzymes [BR:gxy01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     GLX_27710
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3087774..3088343)
Genome map
AA seq 189 aa AA seqDB search
MDIKTFNIEGMMLLTPPRFEDDRGYFTETYNAARLKELGITEPFVQDNHSLSRQRGVVRG
LHCQLPPHAQGKLIRCTRGSIWDVGVDIRAGSPTFGQWVGQTLSAENGAQFWIPAGFLHG
FCTLTDNAEVQYKCTDFWNRECERSVRWDDPLLAIEWPVSAGDAIVSAKDAQALSFSNVD
DWFTHTADG
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atggacataaagactttcaacatcgaaggcatgatgttgctgaccccgccccgatttgaa
gacgaccgtggctatttcacggagacttacaatgccgcccgcctgaaggagctaggcatt
accgaacccttcgtgcaggataaccatagcctctcgcgccagcgcggggtcgtgcgcgga
ttgcactgccaactgccgccacatgcacagggcaagctgatccgctgcacacgcggcagc
atatgggatgtgggggtggacatacgcgcaggctcccccaccttcgggcagtgggtcggg
cagacactctcggctgaaaacggggcgcaattctggatcccagcaggattcctgcatggg
ttctgcaccctgaccgacaatgcagaagtgcagtataaatgcaccgatttctggaaccgc
gagtgcgagcgttccgtgcgttgggatgacccgcttctggccattgaatggccggttagc
gcaggggacgcgatcgtgtccgccaaggatgcgcaggcgctgtccttttcaaacgtggat
gactggttcacgcacacagccgatgggtaa

DBGET integrated database retrieval system