KEGG   Gluconacetobacter xylinus: GLX_27720Help
Entry
GLX_27720         CDS       T01631                                 

Definition
cellulase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
gxy  Gluconacetobacter xylinus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:gxy00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3088388..3089410)
Genome map
AA seq 340 aa AA seqDB search
MKRSLSCRARRWLTGCVTGAVLVLPVLQPATAQTWRGVNLAGAAYSSSKLPGRYGYDYLY
PKPAEVDYFTQAGMNTFRLSVLWERLQPVLNGPLNPQEVQRVQQFVSYARGKGASTVLDI
HNYGRYRGQEVGSDAVSDAAFADLWSRLAQVFGKDDHVLFGLMNEPQQHSAEAWKASVQG
AIDAIRKTGSHNAILVPGIGWDGAHSFVTLNSPTLGTLTDPAHNLIYEVHEYFDTDASGT
KPACISQDQALARIRAFTDWLHAHKAHGFLGEFGVSRQPECVALLSPLLTHMRENADVWS
GWTYWAAGPLWGNYMFTLEPDHGTDRPQMQAIWPFLGAAR
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgatccctttcctgccgcgcgcgccgctggctgacaggctgcgttacgggggca
gtccttgtgctgcccgtcctccagcccgccacagcgcagacctggcggggcgtgaacctg
gcgggggccgcctattcatcctccaagctgccggggcggtacgggtatgactatctctat
cccaaacccgccgaagtggattacttcacccaggccggcatgaacacgtttcgcctgtcc
gtgctgtgggagcgcctgcaaccggtcctgaacggcccgctaaacccgcaggaagtgcag
cgtgtacagcagttcgtaagctatgcacggggcaagggtgcgagcacggtgctcgatatt
cataactatggccgttaccgggggcaggaagtgggttccgacgcggtatccgatgcagcc
tttgccgacctgtggtcgcggctggcgcaggtgttcggcaaggatgaccatgtcctgttc
gggctgatgaacgaaccccagcagcattccgccgaagcgtggaaggccagtgttcagggc
gcgattgacgccatacgcaagaccggcagccacaatgcgattctggtgcccggcattggc
tgggatggcgcgcactccttcgtcaccctcaacagccccaccctcggcacgctcacggat
ccggcgcacaacctgatctatgaagtgcatgagtatttcgataccgatgcatcgggtacc
aagccggcctgcatttcacaggatcaggcgcttgcccggatccgggcctttaccgactgg
ctgcatgcgcataaggcccacggcttcctgggggaattcggggtcagccgccagcccgaa
tgtgtagcccttctgtccccccttctcacgcacatgcgtgagaatgccgatgtatggtcc
ggctggacctactgggcagccggacctctatggggcaactatatgttcacacttgaaccc
gatcatggcaccgaccggccacagatgcaggccatctggccctttcttggcgcggcacgc
tga

DBGET integrated database retrieval system