KEGG   Gluconacetobacter medellinensis NBRC 3288: GLX_28010Help
Entry
GLX_28010         CDS       T01631                                 

Definition
protein-L-isoaspartate (D-aspartate) O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
gxy  Gluconacetobacter medellinensis NBRC 3288
Brite
Enzymes [BR:gxy01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     GLX_28010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3123937..3124641
Genome map
AA seq 234 aa AA seqDB search
MLQGNVMDKTDPDYAPLDPVAARQRMVDAQIRPAQVSNPAVIAAMRAVPREDAVPPALRA
FAYADQNLPLGEGRYLTEPRVTGRMLQVADIQPGERILVVGAGTGYLAALLSAMGQGLAV
TALESESRLADLGQVLCHQQAPDVQWRNGPLIKGDEADGPYDLILVDGAVRQVPPALVAQ
LAKGGRVVAPICPVGGVTSVCLVLPTAQGGAVQRLFDAAVPLLPELEPAPAFVF
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgcttcaaggaaatgttatggacaagacagaccccgattatgccccgcttgatcccgtg
gccgcccggcagcgtatggtggatgcacagatccgcccggcacaggtcagcaatccggcc
gtgatcgccgccatgcgggcagtaccgcgtgaggatgcggtaccgcctgcgctgcgagcc
tttgcctatgccgaccagaatctgccgctgggcgaggggcgttacctgaccgaaccccgc
gtaacgggccgtatgctgcaggtggccgatatccagcccggggagcggattctggtcgtg
ggtgcgggcacgggttatctggcggcactgctgtccgccatggggcaggggcttgctgtt
acggcgctggaatcagaatcgcgtctggcggatctggggcaggttctgtgccaccagcag
gcacccgatgtgcagtggcgcaacgggccactgataaagggggatgaagcagatggtccc
tatgacctgatccttgttgacggcgcggtgcgccaggttcccccggcgcttgtggcgcaa
ttggccaaaggagggcgcgttgtcgcccccatctgcccggttggtggtgtgacatcggtc
tgtcttgtcctgcccacggcgcaggggggggccgtacaacggctgtttgatgctgccgta
cccctcctgccggaactggaaccggccccggctttcgtgttctga

DBGET integrated database retrieval system